SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013004760.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013004760.1.53824
Domain Number 1 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-41
Family V set domains (antibody variable domain-like) 0.000066
Further Details:      
 
Domain Number 2 Region: 219-274
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000178
Family V set domains (antibody variable domain-like) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013004760.1.53824
Sequence length 275
Comment PREDICTED: uncharacterized protein LOC100716246 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MAFGLSWILLFAIWKGVQAELQLVEYGGSLVPPGGSLTLSCVTLEFPFSSYAMGWIRQPP
GQGLEWLSLIYHDSSKINYANSVKGRFTISRDNGRNTLYLQMNSLRTEDTALYYCAAYTV
RRPQCEPRQKSPCRWSHVRQGADAPLEKVCVDKCIEEEAQPALSPPHPWHRPAGEPEVAT
RDLAFLRLNVAAQEGYLPTLLESTLALAGSRTSVLCEENLVESREGLAQSAGSLRLSCVA
SEFNFRSYWMTCIRQAPEKGLEWISAISEYSSYIY
Download sequence
Identical sequences XP_013004760.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]