SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013006296.1.53824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013006296.1.53824
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 783-1038
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-39
Family YWTD domain 0.0000886
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-27
Family YWTD domain 0.0000829
Further Details:      
 
Domain Number 5 Region: 1169-1205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1131-1167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1090-1130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.023
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000191
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000512
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1048-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013006296.1.53824
Sequence length 1449
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Cavia porcellus]; AA=GCF_000151735.1; RF=representative genome; TAX=10141; STAX=10141; NAME=Cavia porcellus; strain=inbred line 2N; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSEIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDI
QVLSQERQPSFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRARLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGRERHVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINMDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWKDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVNKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLVQG
HLDFVMDILVFHSSRQDGLNDCVHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPP
STFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGSQAFVLTSLGQSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDR
DRPRAITVNAERGYLYFTNMQDRAPKIERASLDGTEREVLFTTGLIRPVALVVDNSLGKL
FWVDADLKRIESCDLSGANRLTLEDASIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGD
KRTRIQGRVAHLTGIHAVEEVNLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVL
LQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSASQFPCA
RGQCVDLRLRCDGEVDCQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSD
ELMCEITKPPSDETPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEY
VSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRSGVPLYDRNHVTGASSSSS
SSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATTRPYRPYIIRGMAPPTTPCSTD
VCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPP
PPSPCTDSS
Download sequence
Identical sequences XP_013006296.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]