SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013041112.1.65836 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013041112.1.65836
Domain Number 1 Region: 17-277
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-56
Family YWTD domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 629-884
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 328-558
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 931-1190
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-38
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 5 Region: 1321-1357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1283-1319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 584-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1242-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 887-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 282-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1200-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013041112.1.65836
Sequence length 1601
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X2 [Anser cygnoides domesticus]; AA=GCF_000971095.1; RF=representative genome; TAX=381198; STAX=8845; NAME=Anser cygnoides domesticus; breed=Zhedong; AL=Scaffold; RT=Major
Sequence
MLLMLICFCFFSSVASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGI
VFWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVAN
LNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYW
PNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQ
TRSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRD
PFYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAI
AIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTSEINHPDGIAVDWVARNLYWTDTG
TDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRV
LVNTSLGWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGD
YIYWTDWQRRSIERVHKIRASRDIIIDQLPDLMGLKATSVAKVFGTNPCAENNGGCSHLC
FFTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKE
ASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWAD
TGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNS
ITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSD
YIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHL
CLAIPNGFRCGCAAHYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGL
RNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSAPNQSQNPEKQPHDLSIDIY
SHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIE
RAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNI
LQPMGLTVLGNHLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEEFSA
HPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCI
PMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDT
LCLPNQFRCASGQCILLKQQCDSFPDCIDGSDELICEKTKPASDEPQPHSSAIGPVIGII
LSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCG
KSMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAE
MFYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYP
PPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_013041112.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]