SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013041115.1.65836 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013041115.1.65836
Domain Number 1 Region: 16-276
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-56
Family YWTD domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 628-883
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 327-557
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-49
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 930-1189
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-38
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 5 Region: 1320-1356
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 583-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1241-1281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 886-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 281-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1199-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013041115.1.65836
Sequence length 1600
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X3 [Anser cygnoides domesticus]; AA=GCF_000971095.1; RF=representative genome; TAX=381198; STAX=8845; NAME=Anser cygnoides domesticus; breed=Zhedong; AL=Scaffold; RT=Major
Sequence
MATVDQKGTGFAAASPFLLFANRRDVRLVDAGGTKLESTVVVSGLEDAAAVDFQYSQGIV
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSTRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTSEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIRASRDIIIDQLPDLMGLKATSVAKVFGTNPCAENNGGCSHLCF
FTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPTSFLLFSQKSAISRMIPDDQQSPDIILPMHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSAPNQSQNPEKQPHDLSIDIYS
HTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIER
AALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNIL
QPMGLTVLGNHLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLTGIHAVEELDMEEFSAH
PCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIP
MAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEVDCDTL
CLPNQFRCASGQCILLKQQCDSFPDCIDGSDELICEKTKPASDEPQPHSSAIGPVIGIIL
SLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGK
SMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEM
FYSSNIPSTTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPP
PPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_013041113.1.65836 XP_013041115.1.65836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]