SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013083069.1.17457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013083069.1.17457
Domain Number 1 Region: 1426-1624
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000763
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 2 Region: 1214-1426
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000131
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number 3 Region: 391-631
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000405
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013083069.1.17457
Sequence length 2110
Comment PREDICTED: myosin-9-like isoform X4 [Biomphalaria glabrata]; AA=GCF_000457365.1; RF=representative genome; TAX=6526; STAX=6526; NAME=Biomphalaria glabrata; AL=Scaffold; RT=Major
Sequence
MQEVDNYCDVNVRGVYRGRPPPRSEEATLRDRRDRYVDSWDLGERRSRSPGSPNRPQERD
DQRVPSPKRVTWKEPVEQKKAQNNDYLSKCRELERELRSISIEKTRAETLIEDLQTKLAR
QEEQTAQIRAQNSNLNYDIDQLIDVVRAARMTGTWEIDRIKFRELTIDQVFGSIHETFPK
LIGKETDSSELLQQVRQKDDRIESLERELRALRFESKGVIVGDQISEPTDLSRVKSDLRR
LEQRVEDLKQEIHSRDRKISGLTSQINDLQAELNMKDSENSNYQQTIKLLQDKIRQSTLE
LTKSEEVSRQLKSDLASIRDQNSQSSHSVSHYERRIRALEAELVEAKDQRRKNLDEIGAL
QEKLREGNISTHDHHEVLKSELARRDDTIQKLRRDVLTLQEKRDSSLAECETAIYRLSKT
EQQLSNAHEEIHRMEKKTKALEDEVLHVRSQLNEADNETKTVNKKVTRLEGELQALRGQN
DEFQGQVNDKQETIVRLRNDYRDLEEKLREALNTAQQRGEAIKQVKEELKQAVMKTQESQ
SKLEEADREHQQLQSRYTVQAKEIDRLQTELQEKELTSSQQETLFRSEVADREEEISRLK
ADLNIYHEKLAQSEGQLISREEQIAQLQSQLRDLMGETSRKEENLRRLEEDLHSVEDERK
RVEDILQRREITLQQVEHDLDMAKEKYNDAIEENGRLEARIQAFAINAQSEQDVLSTEVK
RREEVIKRLKLDGVKLQEICSKYEEKSSQAEREVEHLKTQLRSCHNEVEVKRAAMKNLET
NVEELKDKQGKQLEENSRLEDKIRDLTVAITTQEAQCEKLKHLVSTKEDLICQLRGDAES
LNRQLKETVSKVLVRDENIQKLNVEIGKLKAKTQDKTKEIIECTEEIAKQSELIKKLQNT
LTQCHQDLDELRRRADEDMLHKEEKIKQLQEDLLESQSQHSACYNELVKMEEEFELLKAS
HLQLNKVSQATSAQLTSLHDQINQLELDLTITNEKHRTCQKEVSNRDQVILRLQADLDTA
QQNYSGSMEELKLNESEVKRIAGKLKQLQQEIRESHENLENKDNQIVDYEKRIQELQHDE
EMAVQEAKNHMRTIEQLKSDLQVAKSNAAVEQSRLQEDLDLVKEDLDMTRNELSEFKRSN
ADLKVTIAGLNDDLTRYKNLQDENANEIRRQSDLLKQQENILSETRQQLVISQSQLEAAN
EDIEKLDSALGSYKQKYTQATNQINHLETTVASLQEKLSDSRNQELEREATIEQQRSELE
GLDRAYSERKEEISRCEDMIHQLSEELESTQKELRSAHFRIKEVEDANKELKDRVQDSQH
LALQHEEKAHDFENKLLTYQTDHSHSDREFADKLDQITGLEYQLEENRVDMEGKVRFIEQ
LKSELNLCQSELQQTKDDRTTALNEIEKLEGNIQQLQLNLASAHQRHKSEVCRFEDQVAT
LDRQLNQTQTQLQHAEHDIGSKEGEIKRNEAEIATCREDIRMKVEEIEKLERSLHEAKLE
LNQVHGYNKQLEGNIVDLKSSCETLKQDLNEARSQYKDCAQELAHHEEKLSLIQQSLQST
QDQLSQRVTEVVRHEQNIRKLQTELKTARERIASYEEEMEEQKTTINKLRKDLMAAKEEF
HASVQEGVGHKQQAHKLELELTGAREQEKMLSDQVEQQEHILGQLQTELRAERDRHGETV
RQLSASKKVGLDLQADIEALQKQIREHQERIQAREDQIARHRREIDDLHNKNRETSEVLA
EREGQLRLSNMNLQASQKQARHHTQDISRYEDTLSKLQTDHEKLQEQYRRSSSDLMEADA
KIHELKVQLTTVQGNHKESMEQLTEKSRQLANLKTESAKLAQQNNSMKEEIMFYDEKLRK
LQQELRKTQEINKATDEELQHFEEKYTGLQVDLVSSQERQKQSLQELASREEEFVVLKVE
YSSLQEKYKAATEESSKLINELELLKQNYRSANEEIAGLRAALEESRSNGDRLHRESELV
VQNVNTWVQEQKLANEKLGNKIREQSKAIMVLSAEKETLLDQVTKLQKSYSKVKIELEEK
LAESDKFKALQTHSVHQQIILNQLKSRLEEHEVEQDEDLKTKEAAIEDLHHRLKSNIENI
HKLNQQVKNL
Download sequence
Identical sequences A0A2C9M9B4
XP_013083069.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]