SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013318480.1.29456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013318480.1.29456
Domain Number 1 Region: 5-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.89e-78
Family Capz beta-1 subunit 0.0000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013318480.1.29456
Sequence length 278
Comment hypothetical protein PV05_02452 [Exophiala xenobiotica]; AA=GCF_000835505.1; RF=representative genome; TAX=348802; STAX=348802; NAME=Exophiala xenobiotica; strain=CBS 118157; AL=Scaffold; RT=Major
Sequence
MASEVQFDAALDLLRRLSPLSVTDNLNAITTLVPDLTEDLLSSVDQPLTSARCKKTGRDY
LLCDYNRDGDSYRSPWSNEFEPPLDDATYPSDRVRKMEVEANAAFDVYRQMYYEGGTGSV
YLWDLDDGFAGVVLLKKKSAAGKDEEAAGWDSIHVFEVDERRGSGRTCHYKLTSTVILHL
GRQSEGVGSLNLAGSMTRQVEADLVVENVGGQGKDGGHVCNAGRLIEDMEGKMRNMLQEV
YFGKAKDVVGDLRSVALLTGVNRDRQAQRDVISSMGGK
Download sequence
Identical sequences A0A0D2BZL0
XP_013318480.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]