SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013369680.1.28644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013369680.1.28644
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-51
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 783-1038
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-38
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-27
Family YWTD domain 0.0000829
Further Details:      
 
Domain Number 5 Region: 1169-1205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000118
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1131-1167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1091-1129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 8 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.023
Further Details:      
 
Domain Number 9 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000185
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000596
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1048-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000936
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013369680.1.28644
Sequence length 1449
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X2 [Chinchilla lanigera]; AA=GCF_000276665.1; RF=representative genome; TAX=34839; STAX=34839; NAME=Chinchilla lanigera; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSEIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDI
QVLSQERQPSFHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRARLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGRERHVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINMDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLVQG
HLDFVMDILVFHSSRQDGLNDCVHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPP
STFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGSQAFVLTSPGQSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDR
DKPRAITVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKL
FWVDADLKRIESCDLSGANRLTLEDASIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGD
KRTRIQGRVAHLTGIHAVEEVNLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVL
LQNLLTCGEPPTCSPDQFACSTGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCA
RGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVPIRQQCDSFPDCVDGSD
ELMCEITKPPSDETPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEY
VSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRSGVPLYDRNHVTGASSSSS
SSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPAATRPYRPYIIRGMAPPTTPCSTD
VCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPP
PPSPCTDSS
Download sequence
Identical sequences XP_013369680.1.28644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]