SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013432343.1.85016 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013432343.1.85016
Domain Number 1 Region: 2-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-82
Family Capz beta-1 subunit 0.0000000853
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013432343.1.85016
Sequence length 264
Comment F-actin capping protein [Aureobasidium namibiae CBS 147.97]; AA=GCF_000721765.1; RF=representative genome; TAX=1043004; STAX=559561; NAME=Aureobasidium namibiae CBS 147.97; strain=CBS 147.97; AL=Scaffold; RT=Major
Sequence
MADQFDSALDLLRRLNPKNTAANLSAICSLVPEHEEELLASVDQPLEVRRCKKSGRDYLL
CDYNRDGDSYRSPWSNEFDPPVDDAEMSSERVRRLEVRANEAFDVYRELYYEGGTSSVYL
WNLDDGFAGVVLLKKSSSQAAASGAWDSIHVLEVAERGRTAKYKLTSTVILNLGTKGDAL
GSLDLAGNMTRQVEADMSVDADETHVANIGKLVEDMELKMRNLLQEVYFGKAKDVVGDLR
SIPPLSEANRDRAAQREMISSMAR
Download sequence
Identical sequences A0A074WW64
XP_013432343.1.85016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]