SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013456789.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013456789.1.50012
Domain Number 1 Region: 12-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000275
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013456789.1.50012
Sequence length 133
Comment B3 DNA-binding domain protein [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
mqtggiepltgepyfhvvlskthlstrygmgpsssiceelpskevptilkyrgkswgmty
ngqnktkqfdsvswekfaednylklgdacvfelmknseeeivfkvqilrgeeepillsef
pgtgerdapfvid
Download sequence
Identical sequences A0A072UY87
XP_013456789.1.50012 Medtr4g083390.10 Medtr4g083390.4 Medtr4g083390.5 Medtr4g083390.6 Medtr4g083390.7 Medtr4g083390.8 Medtr4g083390.9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]