SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013465214.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013465214.1.50012
Domain Number 1 Region: 790-1019
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000000981
Family Tropomyosin 0.00086
Further Details:      
 
Domain Number 2 Region: 552-792
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000000131
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 3 Region: 199-443
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000752
Family Tropomyosin 0.00096
Further Details:      
 
Weak hits

Sequence:  XP_013465214.1.50012
Domain Number - Region: 466-545
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013465214.1.50012
Sequence length 1302
Comment frigida-LIKE protein [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MDFEPIDDVREHVPLLPTFSRVSSLEKCSSSAVKKRGSDFHDNSNSLHLSVKKSKLLNDD
HHNDISLSKKLTDKSFSSLKKDLAVLEKLFEECKRKQKVEERRLQSIKRETEECCKDLQI
KMDQVSVVRRIDDACEKVQEKIDDCIKEFVVKEEELYLMENLIKESKLELKAKEIELDQV
KGNISKEIELRQVIDNIDKDHERKEEEIKALSQKIAELALDCKAKENELDAVNKLIGEQA
EKLESERKKARNIISEMKNSIAQMKEFESKQKRFDDRFKELESKEKKCEEWVTKLDSREK
QLEGRVNESESKEKELEGRMNELESEKEHFKNRVKELDTKEKQVEGRAMELESKEKRSEG
RAEELQSKEKHFEEWAKKLESREKQLDVRLKEFELNEKEIEGRMNELDKKEKQVEGRAIE
LESKEVQCEVWVKEFESKQKEFEGRLKEHESKEKELEGRVESKKKHFESMMEELKSSMSS
LKGQVEELDSKEKQLDGQVKELESQKNHFESQVKEFESKKKELELKDNELVGKVKKFESK
EKEFEYLMMGSVSKQEHFENRMKDLELKEKNFEGRVKELEFKKQQIESQMKELELKQKHF
ESQMKEFESKEKQHEGWVKEHGSKEREFEGQMKDLESGRKHFESQVDELKSKERQFEGQA
KQLESKRKHFESQMKEFESKEKQLDSQVKELESKKKLFESQVKELKSKDNQLVGQLRKFK
SKERQFEGQAKQLESKRKHFESQMKEFESKEKQLDSQVKELESKKKLFESQVKELKSKDN
QLVGQLRKFKSKEREFEGQAKQLESKRKHFESQMKEFESKEKQLEGQVKEHKSKERGFEG
QLKELESKKKHFENQVEEFKSKERQLKGQVKEIESKEKKFDGRVKEFESKEDDFEGRMKE
HESKEREFEIQVKELQSKKKQVESQVKELESKDNQLICKIKEFESKEKEFEEQVKDIKSK
EEELESKKKHFESQVEEFKSKEKQFEERWNKLESEENKFKAKVKELNFKEKWFEGQVKDP
VSRKKYIDGEKESVASYMYDQSSHAFGGISLQLGTSEKTDGVESLFNGVLVNLQESSDPS
KLVLEMILNPIIPRCQKGDNVIITDYQIHLLEQLMRISPDIEPCEREKALKLAYDLKENM
KDNTEKSLAVLGFLLLLSIYKLLDSFDEDEVLDLFAFVALHKIAVELFGCLGFANRVSDF
VKRLIMRKQIVEAVQFSCAYNLTDKDQLVDMLQEHVQNAKLICESSCKKTNSIEIKDKAR
DQEIASLGTVLQCISVSSLESAGLLHKEIDYRILELKAHKGC
Download sequence
Identical sequences A0A072VB44
Medtr2g091110.1 XP_013465214.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]