SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013466760.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013466760.1.50012
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000687
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013466760.1.50012
Sequence length 222
Comment hypothetical protein MTR_1g035510 [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MVPRNFVDKYWKGMSNPISLKFPNGYECKMFWIQLGDDVWFLNWKRFARSLRYGDLLVFQ
YKGGSDFYVIILDDSKLEIDYSSMQYNDDHDSNKHCKLEESDDDCIEILNDIATNSATPH
GTNIDKTKFNMNATKQNVSGYEGRTSSCKHNTGKRKLFAGTSSSRHVLSDSEGPNVMKQN
TFELVVNSSYPCVPNEFLSKHEDLHGKFVELKVGGKSWALDV
Download sequence
Identical sequences A0A072VGT7
XP_013466760.1.50012 Medtr1g035510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]