SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013469920.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013469920.1.50012
Domain Number 1 Region: 39-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000353
Family B3 DNA binding domain 0.0073
Further Details:      
 
Weak hits

Sequence:  XP_013469920.1.50012
Domain Number - Region: 178-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000255
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013469920.1.50012
Sequence length 274
Comment transmembrane protein, putative [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MAFHHNNVAMLSYSMLIAPLDPNPVTEMDRRINELRLKYRTYMVEVDVDYGAIMLPMMFS
HDFGDQIQQYATLVDPKRNQFEVLVERNNQGIYLTKGWHAIRDFYKVQFGSWVTVVFMGD
GRFDIRMKNKFGKRIRYPTFNPPMNFRVEHSAVPVTVDWFVPRPFMHDGMNFQFTYEKKL
AVADVESGFLELAEVGFAQMALDRETSIVDMVDENGNIWNCTLSFSMNPAPNFKIGGGWE
LMVKARKFAEGVRVVVGAPAVGMNLTLYFCVIRR
Download sequence
Identical sequences G8A101
Medtr1g105765.1 XP_013469920.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]