SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013720407.1.73403 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013720407.1.73403
Domain Number 1 Region: 289-391
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 158-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-19
Family B3 DNA binding domain 0.0033
Further Details:      
 
Domain Number 3 Region: 27-91
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000049
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013720407.1.73403
Sequence length 499
Comment PREDICTED: B3 domain-containing protein REM1-like isoform X2 [Brassica napus]; AA=GCF_000686985.1; RF=representative genome; TAX=3708; STAX=3708; NAME=Brassica napus; cultivar=ZS11; AL=Chromosome; RT=Major
Sequence
MTIPPTFSLFHHRFITGDKPVLTVDDEFLRKHTKVLLISDSSDKIWKVKLDGSRLAGGGW
EEFAKAHSFRDGDLLVFRHDGDEIFHVSVSPRSDSCDISHHASPSLVDTDDVETDDDYSE
SDDGEDEYDDDDDGGEDDAGNIMVNKNTKAGFSCILRARVTPYSLIKDRLDLSKDFTVVS
FNEHNKPCEIDLVNEKGRKWTLRLSKNSTSGVFYIRQGWVNFCSANGLSQGDICKFKLSE
NGERPVLRLCPSSNSHEEEEECLEADAVKTSSIRGCSKEKRKGKKKNSPSQFLTVKLTPN
RLQTGQLYISSVFVNESGIKKSGEITLMNKDGRKWPSYLQMTGQCGSEWFYLRHGWREMC
KANGVKVNDSFVLELIWEDDNPVFKFCSKAENKGNGNGRLRKKRACETSIVETERRKRGR
PRVSNTNSSNLQRTRQESCSVSDQVASVKLSILDTLNTVRQFRADIEAREKNLEASSLEV
DALGERILGISQILNNNLV
Download sequence
Identical sequences M4D179
Bra010228 XP_009108916.1.100322 XP_013720407.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]