SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013779805.1.66592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013779805.1.66592
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.95e-85
Family Calponin-homology domain, CH-domain 0.00000194
Further Details:      
 
Domain Number 2 Region: 247-366
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-35
Family Spectrin repeat 0.0000798
Further Details:      
 
Domain Number 3 Region: 1492-1638
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-31
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 4 Region: 2114-2226
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-31
Family Pleckstrin-homology domain (PH domain) 0.0000609
Further Details:      
 
Domain Number 5 Region: 555-693
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-29
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 6 Region: 1175-1328
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-29
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 7 Region: 767-902
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 8 Region: 963-1103
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-26
Family Spectrin repeat 0.0000807
Further Details:      
 
Domain Number 9 Region: 1812-1966
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-26
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 697-800
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 11 Region: 330-475
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 1651-1755
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 13 Region: 479-589
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-17
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 14 Region: 1303-1434
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 15 Region: 1954-2053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000968
Family Spectrin repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013779805.1.66592
Sequence length 2264
Comment PREDICTED: spectrin beta chain-like, partial [Limulus polyphemus]; AA=GCF_000517525.1; RF=representative genome; TAX=6850; STAX=6850; NAME=Limulus polyphemus; AL=Scaffold; RT=Major
Sequence
ERESVQKKTFCKWVNSHLVRANCRITDLYLDLRDGKMLIKLLEILSGERLPRPTKGKMRI
HCLENVDKALQFLREQRVHLENLGSHDIVDGSARLTLGLIWTIILRFQIQDITIEEVDNQ
ETRSAKDALLLWCQMKTAGYPNVNIRNFTTSWRDGLAFNALIHKHRPDLIQYERLSRSNA
TYNLNNAFNVAEQKLGLTKLLDPEDVYVDCPDEKSIITYVVTYYHYFSKMKAETVQGRRI
GKVVGEAMENDRMAHEYETLTSDLLQWIEHTIAALSDRHFANSLVGVQQQMTSFNTYRTV
EKPPKFIEKGDLEVLLFTLQSKMRANNQKPYFPKEGKMISDINKAWEKLEKAEHERELAL
REELIRQEKLEQLAARFDRKAGMRETWLSENQRLVSQDNFGFDLASVEAAAKKHEAIETD
IYAYEERVQAVVAVAQELEAENYHDIDRINARKDNVLRLWNYLLELLRSRRGRLELSISL
QQTFQEMIYILDSMEEIKARLLTDDFGKHLMGVEDLLQKHSLVEADINVLGERVKAVVQH
VQQFIFEDPKGGYQPCEPQVVKDRIHQLEAAYSELVQLALERRNKLEESRKLWQFYWEMT
DEEAWIKEKEQILSQGDIGHDLTTVQLLISKNKALEDEILVHEQQLRGVIQIGEDLITAH
HFGSSSIKNRIEDIQGMWEHLKNLQALRTKRLNEAVDYHQFFADADDVDTWMLDSLRLVS
SEDVGRDEANVQSLLKKHKDVTDELKNFSNTIDMLHEQANNLGEQDREAPEVLERLASID
RRYKELLDLAKLRKQRLLDALSLYKLFNEADGVEQWIEEKEKMLDSMVMSRDMEDIEVMK
HRFEGFEQEMNSNASRVAVVNQLARQLLHVEHPNSEEITARQNQLNHKWAALSEKADHKR
EEINLAHGVQTFHIECRETISWIEEKTKLLQATEELGNDLTGIMTLQRRLSGMERDLAAI
QAKLDSLEKEAENIQKDNPEEAESIRERIVQIKEVWENLTHLLKDRDSKLEEAGDLHRFL
RDLDHFQAWLTKTQTDVASEDIPSNLAEAEKLLSQHQQIKEEIDNYTEDYKNMMDYGEQI
TQDQTDPQYMFLRERLRALQDGWTELQKMWENRQQLLSQSLNLQMCMRDGKQAEVLLNQQ
EHYLFKDETPTSLEQAENMIKDHEAFLTTMEANDEKINSVIQFSQRLCDEGHFAADKIHK
KAENIAERRTANRDRANEQMEKLKDQLQLHQFLQNCDELSDWMQEKYIIAQDESYRSAKT
VHSKWTRHQAFEAELASNKHRLLKVDETGRELIAEKPEMKETIEPRLNELAQQFEALEKI
TEEKGQKLFDANRQVLYEQTCDDIDGWITELENQVLTAETGQDLTSVNLILQKQQMIETQ
MAMKEKQVSEIKDQAAYLEKMDPDKIEEVTAKKQYVENRFQKLQAPLLERKEQLLKKKEA
YQFRRDVEDEKLWIQEKMPLATSSDYGNSLFGVLMLKKKHQSLRTEIDNHEPRIMNICDN
GDKLINEGHEDSEEFKKLIEELLSLWEELKNATDNRKKKLDESEKAHQYYFDASEAEAWM
SEQELYMMVEDRGKDEFSAQNLMKKHQSLENEVEDYAETVRQLGETAKELIAEGHPESDV
IAVRQSQVDKLYAGLKDLALERRGKLDEALKLFSLNREVDDLMQWIAEREVVAGSHELGQ
DYDHVTMLRDRFKEFARDTEVIGTERVTNANENADHLINIGHSDSATIAEWKDTLNEAWA
DLLELIDTRTQMLAASWRLHRFFHDCKDVYARILEKQNALSDELGRDAVSVSHLQRKHGS
FEHDLQTLEIAVQQIKDESADLQTAYAGDKAMEITSREGDVVNAWLVLLSMCENRRVKLA
DTGDLFRFLNMVRDLMLWMDDVIRQMNTSEKPRDVSGVELLMNNHQSLKAEIDAREDNIS
VCINLGKELLSRNHYASAEIKEKLLTLTNQKTSMMERWEERWEHLQLILEVYQFARDATV
AETWLIAQEPYLLSQELGHTIDEVEQLIKKHEAFEKSATAQEERFSALERLTTFELKEYK
KREEEEAERRRQEELARQAPPEPVVEEIITGDRVDGQPSPVEDKEQAVVNGEQELVEEGK
PEEKSSPVSAPSEEDTQFEGLLVRKHEWESTTKKATNRSWDKIYLVLRGSMLLAYKDQKH
YKQEPEFYFRNESPIDLRGATVEVASDYTKKKHVFRLKLSAGGEYLFQGKDDDEMNSWIQ
KLQVALTEADGSAGPSRSQTLPAKAEGERKDEHKRRSFFTLKKN
Download sequence
Identical sequences XP_013779805.1.66592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]