SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013802209.1.3284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013802209.1.3284
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-92
Family Calponin-homology domain, CH-domain 0.0000037
Further Details:      
 
Domain Number 2 Region: 296-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-34
Family Spectrin repeat 0.0000828
Further Details:      
 
Domain Number 3 Region: 602-739
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-27
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 4 Region: 817-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-25
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 1535-1690
Classification Level Classification E-value
Superfamily Spectrin repeat 2.29e-25
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1643-1796
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-24
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1854-2008
Classification Level Classification E-value
Superfamily Spectrin repeat 3.77e-24
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 1011-1150
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-23
Family Spectrin repeat 0.0000404
Further Details:      
 
Domain Number 9 Region: 1223-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-23
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 10 Region: 425-527
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-22
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 739-854
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 12 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.00076
Further Details:      
 
Domain Number 13 Region: 2014-2074
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000877
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 14 Region: 1384-1479
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000561
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013802209.1.3284
Sequence length 2143
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X4 [Apteryx australis mantelli]; AA=GCF_001039765.1; RF=representative genome; TAX=202946; STAX=8822; NAME=Apteryx australis mantelli; AL=Scaffold; RT=Major
Sequence
MTSENDYDHLEIQQQYSRINVRWDASDDELDNDNSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVTCRISDLYMDLRDGRVLIKLLEVLSGELLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIIVQTQEGRETRSARDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPELVDFHNLTKSNARHNLEHAFSV
AERHLGITPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLEVEGRRLGKVIEHAKET
ERMIEGYSGLASDLLTWIEQTIASLNSRNFANSLAGVQHQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQRVYTPHEGRLVSDINRAWEQLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMREAWLSENQRLVAQDNFGQDLPAVEAAKKKHEAIETDTAAYKERVQA
IKAVAKELEAENYHDIKRINGRKDNILRLWEYLLELLHARRQRLEMNLTLQHLFQEMLHS
IDWMDEIKAQLASPEFGKHLLEVEDLLQKHRLLEGDMAMQAEKVRAVSSAALRFADADGY
RPCDPKVIRDRVSHLEMCRRELQALAAQRKARLEQSKRLWKCFWELDEAEGWIKEKEQIY
SSLDYGKDLTGVLLLQRKHAAFEAELRGRGGQLEQALVAGKHLVAAGHAEAARLRGRMAE
VRALWAQLQELAAFRQRSLRDAESFFQFQVDADELKTWLQDTRRLAGSEELGHDESSTRA
LVKKHQELLEEVASAEQLLSTLGQQAEDFPPELRAGPEAQSRLTALQALYSEVASLAELR
RRKLQDSLDLYTIFSETDACQLWMGAKETWLEQMDIPNTLEDLDVVQHRFDSLEQEMSSV
ASQIDGINRAADGLIESGHPRSPHIQQCQEQLNTRWGRFRELVAQRQKAVDSALSLLNYC
VDCEETRKWILSKTRVVESTQDMGRDLAGVLAIQRKLYGIERELAAAESRLGSLRPQAQR
LAEDHPDLATDVQERLGATVAAWDELQGALQSQAASLGEAGKLQRFLQDLDDFQAWLFGA
QKAVASDEVPASLAEAEQLLRQHMATQEDIEQHEAAYRNVKEMGERVTQGQVDPEYEQLR
QRLEGMDTGWGVLRKMWDTRHRFLTQCLGFQEFLRDAKQAEVLLSNQEFTLAHLELPNTL
EGSAAALRKFEDFRASMESSEEKIPSTVASGTKLVADGNIFSEKITEKCQSLQERHRANV
AKAQEAAGLLQDNHELQTFLQNWQELTLWINEKMLTAQDKSYGVARSLHSKWLKHQAFMA
ELAANQGWLEKIDMEGKELAGRKPQYGALVSQRLSELHALWDQLQAATEEKAQQLFEVNR
SELYAQSYSDLDRWLGKMEDELRATEQPKDLTSTNLLLKRLTRLEEQVGARKKEMEELVS
QGAPLGGAAQEADSQEQKLQQRFLNLLESLERRRKELESFKTMYQLRRDLEDETLWVQER
LPRARSTDHGTDLQTVQRLMKKNQTLQKELAGHAPRVAEVLSRGDTVVAEASGQCPELET
QVRELQGLWDTLQTETRDRLRRLHEANEAQQYYLDAGEAEAWISEQELYMVADEKPKDEE
SGLVMLKRHVRQQRSIEDYGQNIKELAGRAQQLLSAGHPEGEQIIRLQGQMDKHYAGLKE
AAEERRRRLENMCHLFQLKREVEDLEQWIAERDVVASSQEMGQDFDHATLLREKFREFAW
ETGSVGQERMDRVNLTIEDLIDAGHTEAATMAEWKDGLNESWADLLELIDTRRQLLTASH
DLHKYFYDAAEILALIADKQKELPQDLGCDTSTAKAFHRMHTAFERDIQLLEAQVQQFRE
VAARLQTAYAGEKADSIQQQEQEVVRALRALLEACSGRRAQLLDTAEKFRFFNMVRDLLS
WIESIIRQIETQEKPRDVSSVELLMKYHQGIKAEIDTRDKSFTTCIDLGKKLLQRKHHEA
PEIKAKLVELVEKRRAMVETWDRRWDWLRLLLEVCQFSRDASVAEAWLIAQEPYLASGDY
GHTVDSVEKLLKRHEAFEKSTATWEERFAALRKLTTLELLGKRKLQEEPAQGKVTRTSAP
DYDLDLDAELEAGSEEEEEKKKKGLIVQDASPPAPDRPEPVSY
Download sequence
Identical sequences XP_013802209.1.3284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]