SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013875635.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013875635.1.33752
Domain Number 1 Region: 14-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 297-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-35
Family Spectrin repeat 0.0000654
Further Details:      
 
Domain Number 3 Region: 2168-2285
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-34
Family Pleckstrin-homology domain (PH domain) 0.00000384
Further Details:      
 
Domain Number 4 Region: 1647-1802
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-30
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1541-1697
Classification Level Classification E-value
Superfamily Spectrin repeat 6.09e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 1012-1168
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-28
Family Spectrin repeat 0.0000231
Further Details:      
 
Domain Number 7 Region: 1225-1378
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-28
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 8 Region: 641-745
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-27
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 9 Region: 817-953
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 1860-2014
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 427-527
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-23
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 531-639
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-21
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 13 Region: 749-850
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-21
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 14 Region: 1386-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-17
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 15 Region: 2019-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000202
Family Spectrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013875635.1.33752
Sequence length 2344
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1-like [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MTSVAAELEHMEIQQQQYNNDGVNNRWDADDWDNENSSARLFERSRIKALADEREAVQKK
TFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDK
ALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDA
LLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAF
NLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAI
ETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTE
KGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRTELIRQE
KLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERV
QAVVSVAKELEAESYHDIKRITARKDNVIRLWEYLLELLKARRQRLELNLGLQRVFQEML
YIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQVDRVRNVNSNAQRFATDT
DGYKPCDPQIIRDRVAHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKE
QILSSEDYGKDLTGAVRLLSQHKAFEDEMSGRAAHLQQTIKQGEELVADNHFGAEKIKER
IQDIQEQWAALERLSAVRKARLQEACNQHQFQADADDIDTWMLDVLRIVSSVDVGHDEFS
TQALVKKHKDVAEEIGSYRPVIEALHDQARTLPPEKADSEEVQTRLAGIEERYKEVAELT
RLRKQALQDALALYKMLSEASACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEM
NSQASRVAVVNQVARQLIHCGHPSEKEIKAQQDKLNTRWSQFRDLVDQKKENLNSALGVQ
NYHLECNETKSWIKEKTKVIDSTQELGNDLAGVMALQRKLTGMERDLVAIEDKLSDLGKE
AERLASEHPEQSEAIRGRLAEITGVCGDMKDSLKNREESLGEASKLQQFLRDLDDFQSWL
SRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQYM
FLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMP
TTLEGAEAAIKKQEDFMTTMDANEEKISGVVDTGRRLVADGNVNAERIQEKVDSIDQRRK
KNRQAANDLLSRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMSYDEARNLHSKWLKHQA
FMAELQSNKEWLDKIDKDGQTLMTEKPDTEAMVKEKLASLKTMWNDLESTTQTKAKCLFD
ANKAELFTQSCADLDKWLTTLDGQLQSDDYGKDLTSVNILLKKQQMLESQVDVRQKEVEE
LQKQSQALSQEGKGSDEVDGQRISVEKKFHGLQAPLQKRRENLMASREIHQFNRDVEDEI
LWVEERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHILREGSPT
AELIRHRLTDLQSLWEQIKKETEKRHSRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEE
KAKDEQSSVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPDSERIGMRQSQVDKL
YAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQER
FREFARDTGNIGQERVDGVNRLADELINSGHGDAATIAEWKDGLNEAWADLLELIDTRTQ
ILAASYELHKFYHDAKEILNRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQ
VRQLQEDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLEAAEGRRVKLADTGDKFRFFSM
VRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTVCIELGKALLA
RKHYASEEIKEKLLQLTDKRKEMIDKWENRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPY
LSSREIGQNVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRRQEEEERKRQ
PAEAADAAAQHREGEPVSQNGLPSEQESPREAVDGSDVVNGVSEPSPSGSPGASRKAKPS
QAATLPAKTQQDAPTSLLESFLHRKHEWEGHNKKASNRSWHNVYCVINHQEMGFYKDQKS
ASQGIPYHSEIPVSLKDAVCEVAVDYKKKKHVFKLKITDGNEYLFQAKDDEEMNTWISKI
SAAMAGEKPEVTPSSHSTPAPAPAPRAQTLPASVAAATTTAAESSPGKREKDKEKRFSLF
SKKK
Download sequence
Identical sequences A0A2I4C6M1
XP_013875635.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]