SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013890093.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013890093.1.33752
Domain Number 1 Region: 637-892
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-55
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 25-285
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-53
Family YWTD domain 0.00000143
Further Details:      
 
Domain Number 3 Region: 336-574
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-52
Family YWTD domain 0.00000412
Further Details:      
 
Domain Number 4 Region: 940-1199
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-40
Family YWTD domain 0.0000333
Further Details:      
 
Domain Number 5 Region: 1330-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1250-1291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 7 Region: 895-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family EGF-type module 0.02
Further Details:      
 
Domain Number 8 Region: 593-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000161
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 9 Region: 1292-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 289-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000679
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 11 Region: 1209-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013890093.1.33752
Sequence length 1620
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like isoform X2 [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MGVSLRSLLLLWTFCCLVRGPAGEPLLLYANRRDLRIVDVEHEKTNGTVVVEGLEDAAAV
DYVYSQGLVYWSDVSEEAIKRTFFNQSGHSVVQTVLPGLTSPDGLACDWLGRKLYWTDSE
ANRIEVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSI
IIDKDINWPNGLTLDYSELQLYWADAKLNFIHRADLDGSARKVVIKGDLPHPFALTLFQN
TLFWTDWTTHSIHSCSKLTGQNQRLVHSNIFSPMDIHVFSPQRQPVSSTWCSVNNGGCSH
LCLLSPSRPFYRCACPTGVQLLEDSKTCRDGATQMLLLARRTDLRRISLDTPDFTDLILQ
VEDIRHAIAIDYDPVEGYVYWTDDDVKAIRRALLDGSHAQFVVTSQVSHPDGIAVDWIAR
NLYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPTAGYMYWTDWGEVPKIERAN
MDGTERLVMVNTSLGWPNGLALDYNEQKIYWGDAKTDRIEVMNMDGSARRVLVKDRIPHI
FGFTLLDDFIYWTDWQSRSIERVHKHTAERETIIDQLPDLMGLKATKVHQAFGTNPCADS
NGGCSHLCLFTPHGVQCDCPIGLELIADMRTCIIPEAFLLFSRHTDIRRISLETNNNNVA
IPLTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWL
GKNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDR
AAMDGTGRVTLVADVGRANGLTIDYSERRLYWTDLDTTLIESSNMLGQDREVIADDLPHP
FGLTQFQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNTCAS
TNGHCSHLCLAVPIRGFVCGCPAHFSLNSDNKTCNAPTSFLLFSQKNSINRMVIDEQQSP
DIILPIHNLKNVRAIDYDPLDKQLYWIDSKQNVIRRTQEDGNQSTTVVSSFVVAPGPGLQ
LFDLSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTN
LQERSPKIERAALDGTEREVLFFSGLGKPVALAIDDEVGKLFWVDSDLRRIESSDLSGAN
RVVIADSNILQPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKVQARVAYLSDIHAVQ
ELDMKDYSKHPCTNDNGGCSHICVVKGDGTTRCSCPIHLVLLPDELTCGEPPTCSPKQFT
CRSGEVDCIPNTWRCDGYVECDDSSDEEDCPVCSESEFQCDSRQCIDXSLRCNGEVNCQD
KSDENECEVRCPADQFSCSNGQCIGKHKKCDHNMDCSDNSDEIGCYPTEEPQPSSNNTIS
SIVGVVMALFVVGAIYFVCQRVLCPQMKDDGETVTNDFVVHGPSVPLGYVPHPSSLSSSL
PGMSRGKSVIGSLSIMAGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVR
SQYTLEFGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPLRPAAAS
KGYASDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A2I4DCX4
XP_013890093.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]