SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013924062.1.67126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013924062.1.67126
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-54
Family YWTD domain 0.00000146
Further Details:      
 
Domain Number 3 Region: 331-566
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 935-1195
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-40
Family YWTD domain 0.0000366
Further Details:      
 
Domain Number 5 Region: 889-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000153
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000256
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000102
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 11 Region: 1205-1258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000612
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013924062.1.67126
Sequence length 1618
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Thamnophis sirtalis]; AA=GCF_001077635.1; RF=representative genome; TAX=35019; STAX=35019; NAME=Thamnophis sirtalis; AL=Scaffold; RT=Major
Sequence
MGAVLRSLLVCGLCALARASPLLLYANRRDLRLVDAADVTENATIVVGGLEDAAALDFVF
MHGLIYWSDVSEEAIKCTEFNQSGSVQNIVISGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPVRGFMYWTDWGEMPKIERAGMDGSSRSVIINAD
IYWPNGLTLDYEEQKLYWADAKLNFIHRSNLDGTHRQAVIKGSLPHPFALTLFGDTLYWT
DWTTRSILACNKYTGQNLREIHSNIFSPMDIHVFSQQRQPSATNPCKDNNGGCSHLCLMS
PIKPFYQCACPTGVKLLENKKTCKDGAMELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFLDGSASQFVVQAQIAHPDGIAVDWVARNLYWT
DTGTDRIEITRLNGTMRKILISENLEEPRAIVLNPMTGYMYWTDWGEVPKIERAALDGSD
RVILVNTSLGWPNGLALDYIENMIYWGDAKTDKIEVMKTDGTSRRVLVEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVYRTMGTNPCAESNGGCS
HLCLYRPQGLRCACPIGLELLSDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERSTLVPNVGRANGLTIDYVKRRLYWTDLDTNLIESSNMLGLDRDVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQNHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNPDNRTCSAPTSFLLFSQKNAINRMVIDGLKSPEIILP
IHSLRNVRAIDYDPLEKQLYWIDSRQNIIRRSQEDGSQSSTIVTSPVPNQNLDIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRLMGVVLKNDQDRPRAIVVNPEKGYMYFTNLQERS
SPKIERAALDGTEREVLFSSGLSKPVALAIDSHLGKLFWADSDLRRIESSDLSGANRIVL
EDSNILQPIGLTVFEKWLYWIDRHQQMIEKIDMTRQEGRTKVQARIAQLSDIHAVKELNM
QEYRKHPCSQDNGGCSHICIIKSDGTTRCSCPMHLVLLEDELSCGEPPTCSPQQFTCYTG
EIDCIPVAWRCDGYTECEDASDEKNCPLCSDSQFQCESGQCIDAALQCNGEPNCQDNSDE
KKCEVLCLTDQFRCASGQCIGKNKKCDHSLDCNDNSDEQGCYTTEEPAPPATNTIGSVIG
VILTVFVVGAMYFVCQRVLCPRMKGDGETMTNDYVVHGPSSVPLGYVPHPSSLSGSLPGQ
IYTGMSRGKSVISSLSIMAGSSGPPYDRAHVTGASSSSSSSIKGTYFPPILNPPPSPATE
DSRYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVMTMGGKG
YASDLNYDSEPTPPPPTPRSQYLSAEENYESCPPSPYTERSYTHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_013924062.1.67126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]