SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013947211.1.20613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013947211.1.20613
Domain Number 1 Region: 4-367
Classification Level Classification E-value
Superfamily Translation proteins 3e-109
Family Ribosomal protein L3 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013947211.1.20613
Sequence length 391
Comment hypothetical protein TRIATDRAFT_297774 [Trichoderma atroviride IMI 206040]; AA=GCF_000171015.1; RF=representative genome; TAX=452589; STAX=63577; NAME=Trichoderma atroviride IMI 206040; strain=IMI 206040; AL=Contig; RT=Major
Sequence
MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDAKKPVHLTATMGYKAGMTTIVRDL
DRPGAKANKKEVVEAVSIIDTPPMIVVGLVGYIETPRGLRSLTTVWAEHLSDEVKRRFYK
NWYKSKKKAFTKYAKKHSDNSGSTITRELERIKKYCTVVRVLAHTQIRKTPLKQKKAHLM
EIQINGGSVAEKVDFGKDLFEKPVSIDSIFEQDEVIDVIAVTKGHGFSGVTSRWGTKKLP
RKTHKGLRKVACIGAWHPSHVQWTVARAGQEGYHHRTSVNHKVYRIGKGDAEDSASTETD
VTKKKITPLGGFVRYGEVNNDFVMVKGSIPGTKKRVVTLRKSMWTHTSRKALEKISLKWI
DTSSEFGHGAFQTPAEKKQFQGTLKKDLASA
Download sequence
Identical sequences G9NJH8
jgi|Triat1|156281|estExt_Genewise1Plus.C_120388 XP_013947211.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]