SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013968894.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013968894.1.84170
Domain Number 1 Region: 37-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-32
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 2 Region: 621-699
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.13e-22
Family DIX domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013968894.1.84170
Sequence length 704
Comment PREDICTED: dixin isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MGTQVVRRLCNTLLPAEPSESMPAKQMLPGSKLSDSFMFLMQQLQAYVAWVNAQLKKRPA
VKPVQDLRQDLRDGVILAYLIEIVAGEKLNGVQLSPSNQQEMKNNVEKVLQFVASKKIRM
HQTSAKDIVEGNLKSIMRLVLALAAHFKPGSSRTVSQGRDSRAPLQSHQPHCATAVAQGA
AAALADVCHDMSRSGRDVFRYRQRNNSMDEEIENPYWSVRALVQQYEGQQRSPSESSCSS
LTSPSPIHSAKSESIITQSEEKADFVIIPSEGIENRTEETDSPFSRDWRPGSPGTYLETS
WEEQLLEQQEHLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIII
QSRLDQSMEENQDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDK
DELHNQNVDLQRKLDERNRLLGEYKKELGQKERLLQQHQVKLEEALRKLSEASYQQVDLE
RELEQKDVLLAHCMKREADEVTNYNSHNSQSNGFLLPVAGKGAASITHKGTSDLQLVRDA
LRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHAMETQKKQDRRVRGKSPRSQAGSEYRE
SWPPNSKLPHSQSSPAVSSTCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFKAAIDREGN
HRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWVEEDHGEN
Download sequence
Identical sequences F1PV16
XP_013968894.1.84170 ENSCAFP00000020742 ENSCAFP00000020741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]