SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013975166.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013975166.1.84170
Domain Number 1 Region: 44-201
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.64e-29
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 
Domain Number 2 Region: 214-292
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.98e-28
Family GAS2 domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013975166.1.84170
Sequence length 661
Comment PREDICTED: GAS2-like protein 3 isoform X2 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MTMQPAIQVWFGEDLPLSPRSPLTPRHGPGLADVCQYDEWIAVRHEATLLPMQEDLSIWL
SGLLGTEVKAERLLEELDNGVLLCQLIDVLQNMVKACNSEELENFPMRKVPCKKDAASGS
FFARDNTANFLHWCRHIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPPVL
VKLEKEIELEETLLNTSGPEDSISIPKSCCQHEELHEAVKHIAEDPPCSCSHRFSIEYLS
EGRYRLGDKILFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKG
VSNESVPDSSARTPQPPDMNPLSAVSLFQKQKSKPGPPVGVARSKEKQVRPPGGLLPAAP
LNGGDLGSSHLKLKSSKGAAKKPQAPSGSAAGASTSAAAAPEGSAREPRPLRRGAPPSAP
EARLLPAPRPARPPAAALLPSQPAGKTEPKPLKPAAVRARVGPESPAAAPSASCERPEPR
RANTHLRPRPSPALRPPAKMTKSGPKSTAPRPGPRCPPPAGAARAAPSPSAAAAAAKAAQ
DSEGKAVVPGAKKQPPGQSTSPKRGPGRPRPPGRAPLSLVSLPQASAQSPTARGAARGAA
RGAAGGQPPAPRPPGRGGGPAATRAPPAPRKEAASAGKKPTAKKEVDDHYFVMTGSKKPR
K
Download sequence
Identical sequences E2RMV2
XP_005629334.1.84170 XP_013975166.1.84170 XP_539741.4.84170 ENSCAFP00000010246 ENSCAFP00000010246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]