SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014078035.1.79200 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014078035.1.79200
Domain Number 1 Region: 900-1102
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000144
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 2 Region: 703-927
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000105
Family Tropomyosin 0.0047
Further Details:      
 
Domain Number 3 Region: 333-557
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000131
Family Tropomyosin 0.0039
Further Details:      
 
Weak hits

Sequence:  XP_014078035.1.79200
Domain Number - Region: 1072-1185
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000175
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 1285-1469
Classification Level Classification E-value
Superfamily Tropomyosin 0.000294
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number - Region: 579-691
Classification Level Classification E-value
Superfamily Prefoldin 0.00262
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014078035.1.79200
Sequence length 1677
Comment hypothetical protein COCC4DRAFT_82250 [Bipolaris maydis ATCC 48331]; AA=GCF_000354255.1; RF=representative genome; TAX=665024; STAX=5016; NAME=Bipolaris maydis ATCC 48331; strain=ATCC 48331; AL=Scaffold; RT=Major
Sequence
MASGSKAKDKDPLGASRAHSGLEAILPTNFLDMQKCAGSLPKENKPKSSPRSRPSATPQS
SVPRSVSSMSSSFMQEHWGRSSSYTSKPEHDGEDTHNPQSKEEDAPHVIANWAHLSYIKA
QRNTLRAELKAHQIAGAEAKRSVSSLRRLAFRMAVSISVKEKQIATTARNLAKSRTNHYL
EGKDAQNRVEQLQRALRIEEDRNKEILAALERASMLTLQYSTPKEEPRHNHGNSFLSPPP
SPPTRSSAPDSPFGSPKTPTRSSTAPWHDVDFPLTPRLGSAFEIRTSDSRLIRAKRESDQ
ALAACRRRIEQLQSECAESKEDGRLLAATKAGLEQEMQHHQSQITTLERSRSSLAKELEA
IKVQLQMAVDSEELLKQKLQDKSEELAAWDQKNADMTHTIDLLQKEKTKLDEHVRMQTNQ
VEEFKTRTSVLEQTLHSTRDELENVQRNELSLRERLAEKEKECEDLQKRIDQGLEDIRNL
EQKVNTYDAEAAEHTRKIEIGGNVIAQLREQLYNVEATSKDAHGASADMKKELELLQEKL
RTETEARDGLANELEDLQSGKATVENELRATVEILHEETKAKEELEAKLENLRTSYNDTE
TKLQQALECVQALEAADGVAQTKLETLRDEKSALEANLENVRQLGVKLGESVQMKNNELA
EMKSTSVSLQEKLRQSQKQKSSLQKELEHMRNAKQESDDRHAAEMEKSNEHLRELEASIL
NLRSVLESSEKLGVSLREELGHLRESKRSTEGELEEAHRVKAELEGQICEAQSQHRSTQS
DLDSLQAKIGELENNLTEGQQSKSLLEERLAASTTEVSVLKDRLSDLEAALKDCDDARAK
AEIALSAAQSDGDTTASNLANLRKQAHDMDVARNQLQQELDEAISSKSDLEVQLRSVRDD
LKKSESEANGVQVQLSTLQIQIMDLQQSKQNSEESLNSLQESLSGLDEKLQSTHSQLQNA
HSKISQLETRLASSEEELEAMCRAKAAVEKRLEHAHADNARLEEELRLARQSNEAIRIQL
DNTVDLNSELNENLTVARSEMDEANIQNAKLTSQLREAERELEKLRQLKGDVEARLNKAV
EVSASTEQSLSSARSRLDELESQKSSLNTELAHSRTELDAVRQARTELEAKIEGSERHNK
SLQEDLSGMHSRVAELEANCTNVIAQLSASDQELNSLRLEHAKLEESSQSTSHRTNELQL
ELRAAQMRLEIAESESLDAFNRFLEADKELVSLRNTNVKLEASERELISRLASAEEELKN
ARRMNADLEAFLESVESDIANAYSAVEDTEKRYLEFVEDSEAKLEAAKVSKSRYRTRLCD
KNSELETVTKENSDLHQQIGSQSQEMGALEKSKDELVEELSKKEKYIEELGSSMDERMRS
MNAAYNDLKKKYDQEHQQLGSDHASTVRLEAELARKTTELDQLRHDQETHTTSFTVLQQQ
LASLQTDKQTFESLISTLQEKLKHLELLEEWSTSPTTSPTPLPGTHSTAPSTPKSSHPTH
ISTPNTSPRPDTRASTVSRDPDDVWAHQVEQVRLQRSEAALQLRGLKTSQHHLKKTLRST
DKELNRLEREKTKRSPNLLRKRSRPFSANAAACSDVEGVADEAAAKDKRRMSHGLALLTR
PSTHFHAVGSAGEDGGEAKGKRSAGRRVVSVGDELGRKEKEGRKWGLGLRGLFHRDA
Download sequence
Identical sequences M2UG35 N4XC87
XP_014078035.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]