SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014147256.1.97753 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014147256.1.97753
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily MIR domain 2.62e-18
Family MIR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014147256.1.97753
Sequence length 137
Comment hypothetical protein SARC_14086, partial [Sphaeroforma arctica JP610]; AA=GCF_001186125.1; RF=representative genome; TAX=667725; STAX=72019; NAME=Sphaeroforma arctica JP610; strain=JP610; AL=Scaffold; RT=Major
Sequence
KFSEEVVKNGDKVRLFHVPTGKSMYMHGFPAPVTKELAEVSMDAGAGDEFEVKIDRLKIE
QTKNPLMKRFKSEVREGKALELHNVVRFIHAKTRCAVMMSPKLLPAWGYSQFEVGCIKPT
NTNGTETYPTGTEFTIA
Download sequence
Identical sequences A0A0L0F9F4
SARC_14086T0 XP_014147256.1.97753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]