SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014313256.1.53796 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014313256.1.53796
Domain Number 1 Region: 29-280
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.36e-92
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 296-417
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2176-2294
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-33
Family Pleckstrin-homology domain (PH domain) 0.0000202
Further Details:      
 
Domain Number 4 Region: 602-742
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-30
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 1641-1794
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1533-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-28
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 1852-2006
Classification Level Classification E-value
Superfamily Spectrin repeat 4.47e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1012-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 5.2e-27
Family Spectrin repeat 0.00000348
Further Details:      
 
Domain Number 9 Region: 816-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 10 Region: 1230-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-25
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 11 Region: 426-527
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 746-850
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 530-637
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-19
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 14 Region: 1981-2071
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-16
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1388-1483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000602
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014313256.1.53796
Sequence length 2331
Comment PREDICTED: spectrin beta chain, erythrocytic [Myotis lucifugus]; AA=GCF_000147115.1; RF=representative genome; TAX=59463; STAX=59463; NAME=Myotis lucifugus; AL=Scaffold; RT=Major
Sequence
MTSATEFENVANQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARKSCRITDLYKDLRDGQMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVPEGPEGRETRSAKDAL
LLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFD
VAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRIGKVIDHAIE
TEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEK
GNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEK
LEQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVR
ALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLASRRQRLETTLALQKLFQDMLH
SIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAINTATLQFTEGKG
YQPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQI
YSSLDYGKDLTSVLILQRKHKAFEDELRGLDTHLDQIFQEAEGMVARKQFGHPQIEARIK
EVSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLSGEDVGQDEGATR
ALGKKHKDFLEELEESRAVMEHLERQAQGFPQEFRDSPDVTNRLQALRDLYQQVVAQADL
RRQKLQEALDLYTVFGETDACELWMGEKEKWLAQMEIPDTLEDLEVVQHRFDILDQEMKT
LMTQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSDRREAVGSALRVHNY
CVDCEETSKWILDKTKVVESTKDLGRDLTGVIAIQRKLSGLERDVAAIQTRVGALERESR
WLMESHPELKEDIGRRQAYVEELWQGLQQALQGQEASLGEASQLQAFLQDLDDFQGWLSM
AQKAVASEDTPESLPEAEQLLQQHAAIKDEIDGHQDSFERVKASGEKVLQGQMDPEYLLL
GQRLEGLGTGWDALRRMWESRGHFLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLETPDS
LEAAEAGIRKFEDFLVSMENNQDKVLNPVDSGNKLVAEGNLYADKIKEKVQSIEDRHRKN
NEKAQEASVLLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFM
AELASHEGWLESIDAEGKQLMEEKPQFAALVSQRLEALHRLWDELQATTKEKAQQLSAAR
SSDLRSKTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELF
AQMPSLDEEEGGADMSIEKRFLDLLEPLGKRKKQLESSRAKLQISRDLEDETLWVEERLP
LAQSSDYGINLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEEAEIDCGDIEERL
GHLQSSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYVISDETPKDEEGA
IVMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLAAGHPEGEQIIRLQGQVDKQYAGLKDMA
EERKRKLENMYHLFQLKREADDLEQWIAEKELVASSPEMGQDFDHVTLLRDKFRDFARET
GAIGQERVDNVNAIIERLIDAGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDL
HRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVA
TRLQMAYAGEKADAIQDKEREVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWM
ESIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNFNACLELGESLLQREHQASEE
IREKLQQVMSRRKEMNEKWEARWERLSMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGH
TVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIPEPPVEETGPQEEEGETA
GEGPRGPHRAATERTSPGEEERQWPQDLQPPPPPGPQKEGQEEKSGGDERPATEPLKVLD
TPLSEGDEPITLPAQQDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNHLYCVLRNSELTF
YKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAINESQSIRVKAQSLPLPSITGPDTSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_006091027.1.53796 XP_014313256.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]