SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014328251.1.87360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014328251.1.87360
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-56
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-53
Family YWTD domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 4 Region: 935-1191
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-43
Family YWTD domain 0.000016
Further Details:      
 
Domain Number 5 Region: 1323-1360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000453
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1242-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 891-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 1282-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1200-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000298
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014328251.1.87360
Sequence length 1612
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X2 [Xiphophorus maculatus]; AA=GCF_000241075.1; RF=representative genome; TAX=8083; STAX=8083; NAME=Xiphophorus maculatus; strain=JP 163 A; AL=Scaffold; RT=Major
Sequence
MGMCLRILLLLGSCWLVSGEPLLLYANRRDLRLVDAARDKANATVVVGGLEDAAAVDYVY
AQGLIYWSDVSEEAIKRTSFNRTGAGAAQTVVPGLAAPDGLACDWLGLKLYWTDSDTNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSLLVDQ
DIHWPNGLTVDYGQQKLYWADAKHNFIHRCNLDGSSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGRDQRIVHSHIFSPMDLHVFSPKRQPVSRSSPCSHGNAGCSHLCL
LSPSRPFYRCACPTGVQLLEDGQTCRDGATQMLLLARRTDLRQISLDTPDFTDVILQVDD
IRHAIAIDYDPVDGYVYWTDDDVKAIRRARLDGSDAQFVVTSQVSHPDGIAVDWIARNLY
WTDTGTDRIEVTRLDGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDG
LERLVMVNTSLGWPNGLALDYEQRQIYWGDAKTDKIEVMNMNGTGRRVLVEDKLPHIFGF
SLLGDFVYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATHLHRAAGTNPCADSNGG
CSHLCLHTPQGVRCGCPNGLELLGDLQSCIVPEAFLLFSRHTDIRRISLETNSNTMAIPL
TGVKEASALDFDITDNRIYWTDITLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPVEGYMYWTEWGGKPKIDRAAM
DGTGRITLVSNVGRANGLTIDYAERRLYWADLDTTLIESSNMLGKEREVIADDLPHPFGL
TQYQDYIYWTDWSHRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQAGWNACASTNG
HCSHLCLAVPSSFVCGCPAHFSLNLDNKTCSAPTAFLLFSQKAAINRMVIDEQQSPDIVL
PIQNLKNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQTVTVVSSSLLGPFDLSIDIFS
RFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLQDRSPKIER
AALDGTEREVLFFSNLGKPVALAVDNEAGKLFWVDSDLRRIESSDLSGANRIVIADSNIL
QPVGLTVFGKHLYWIDKQQQMIERIDKTTREDRTKVQARVASLSDIHAVHEIDMNEYRNH
PCTRDNGGCSHICIVKGDGTTRCSCPVHLVLLSNELTCGEPPTCSPDQFACVSGEVDCIP
NTWRCDGFPECDDHSDEKECPVCSESEFQCDSRQCVGQSERCNGEVNCQDGSDENKCEDD
PVRCLADQFSCANGQCIGIHQKCDHNTDCSDNSDEMDCFTDPPELPAPTNSTISSIVAVV
MALFVVGAIYFVCQRVLCPHMKDDGETVANDFVVHGQASVPLGYVPHPGSLSSSLPGMSR
GKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYTLE
FGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRPLKSAAVKGYTSDLN
YDSEPFPPPPTPRSQYLSAEENCESCPPSPYIERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_014328251.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]