SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014349207.1.90931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014349207.1.90931
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily FKBP-like 3.93e-33
Family FKBP immunophilin/proline isomerase 0.00082
Further Details:      
 
Domain Number 2 Region: 218-330
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-29
Family FKBP immunophilin/proline isomerase 0.00067
Further Details:      
 
Domain Number 3 Region: 154-224
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-22
Family FKBP immunophilin/proline isomerase 0.0011
Further Details:      
 
Domain Number 4 Region: 349-414
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000121
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014349207.1.90931
Sequence length 428
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10, partial [Latimeria chalumnae]; AA=GCF_000225785.1; RF=representative genome; TAX=7897; STAX=7897; NAME=Latimeria chalumnae; AL=Scaffold; RT=Major
Sequence
RLGKVIPPDATLVFDVMLVDVWNQDDRVRTRSMSKPDRCNRTVQSSDFVRYHYNGTLLDG
TQFDSSHSLKGTYNTYVGMGWLIKGMDEGLVGMCLGERRSIIIPPFLAYGEKGHGKKASN
FVPYINIPKLAVLGERPPRLGLRPASVLLFLSYSRNHTYDTYIGMGYIISGMDQGLQGAC
MGERRRIIIPPHLAYGEQGVGDNIPGSAVLMFDVHVIDFHNPSDTIEILTVAKPESCNQS
SKSGDYIQYRYNCSLIDGFRLFSSYDQDGPQEAILGGQKVIDGLDLALQGMCVGEKRVVV
VPPHLGHGEKGARGVPGSAVLVFELELVHVEESLPEGYMFVWDADAPANLYEAMDLNKDG
EIPLEEFSTFIKTQVTEKKGRLMPGADPDKTISDMFGNQDRNKDGKITADELKLKTDEDA
EKIQHEEL
Download sequence
Identical sequences XP_014349207.1.90931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]