SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014373234.1.24877 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014373234.1.24877
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-56
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-39
Family YWTD domain 0.0000538
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-27
Family YWTD domain 0.0000943
Further Details:      
 
Domain Number 5 Region: 1173-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000018
Family EGF-type module 0.031
Further Details:      
 
Domain Number 7 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000189
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1095-1133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000512
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1052-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014373234.1.24877
Sequence length 1456
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Alligator sinensis]; AA=GCF_000455745.1; RF=representative genome; TAX=38654; STAX=38654; NAME=Alligator sinensis; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDSSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDI
QVLSPERQPYFHTPCEEKNGGCSHLCLLSPRDPFYSCACPTGVQLEHDGKTCKAGAEEVL
LLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDG
SGAQTLVTTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLNPVMGYMYWTDWGESPKIECAYLDGSERRVLVNTSLGWPNGLALDLEEDKLYWGDAKT
DKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKTRASRDIIIDQ
LPDLMGLKAASVTKVFGTNPCAENNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIYWTDISLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPR
SLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLD
TSMIESSNMLGQEREIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTNGKNRTLIQG
HLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLCLAIPNGYRCGCAAHYTLDPNSRDCRSP
SSFLLFSQKSAISRMIPDDQQSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRA
KDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGEAIGMVL
RGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNK
LGKLFWVDADLKRIESCDLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEK
TNGSRRTRIQGRIAHLTGIHAVEELDMEEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPV
HLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSAAQ
FQCEKGQCIDARLRCNGEIDCQDKSDEADCDTICLPNQFRCASGQCILRKQQCDSFPDCI
DGSDELMCEKNKPPADEPQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNGPF
PHEYVSGTPHVPLNFIAPGSSQHGTFTGKDGISCGKSMISSMSLMGGSSGAPLYDRNHVT
GASSSSSSSTKATFYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTRSYRPYLIRGIAPP
TTPCSTDVCDSDYTTSRWKNNKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERS
YFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1U8D6C5
XP_014373234.1.24877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]