SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014408762.1.101512 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014408762.1.101512
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-93
Family Calponin-homology domain, CH-domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-32
Family Spectrin repeat 0.0000798
Further Details:      
 
Domain Number 3 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-28
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 3.63e-25
Family Spectrin repeat 0.00000747
Further Details:      
 
Domain Number 7 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 1532-1678
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-24
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1227-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-23
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 10 Region: 425-527
Classification Level Classification E-value
Superfamily Spectrin repeat 3.48e-22
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 11 Region: 2176-2264
Classification Level Classification E-value
Superfamily PH domain-like 2.65e-21
Family Pleckstrin-homology domain (PH domain) 0.0000717
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 5.6e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-18
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 14 Region: 1350-1447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 15 Region: 2011-2069
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000734
Family Spectrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014408762.1.101512
Sequence length 2269
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X2 [Camelus ferus]; AA=GCF_000311805.1; RF=representative genome; TAX=419612; STAX=419612; NAME=Camelus ferus; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPSYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGETLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFHKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFIKSLSSVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWKSLEEAEYQRELDLRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKEDYHDQKRITARKDNILHLWNYLQELLQSRRQRLEKTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITASTLQFTEGTGY
QPCDPQVIRDRVSHLEQCFEELSNTAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLQHIFQEAEGMIARKQFGHPQIKARIKE
VSAQWDQLKELAAFRKRNLQDAENFFQFQGDADDLKAWLQDAHRLLSGDDVGQDEGATRA
LEKKHKDFLDELEESRGVMEHLKQQAQAFPQEFRDSPDVTNRLQTLQDLYQQVVAQADLR
QHRLQDALDLYMVFGETDACKLWMSEKEKWLAQMDIPDTLEDLEVVQHRFDILDQEMKTL
MAQIDSVNLAANSLVESNHPRSGEVKQYQDQLNTRWQAFQTMVLGRREAVDSALRVHNYC
VDCEETSKWIMDKTNVVESTKNLGRDLAGVIAIQRKLSGLERDVAAIQARVGTLERESQR
LMESHPELEKDIGPRQAYVEELWQGLQQALKGQEASLGEASQLQAFLQDLDKFQAWLSTA
QKDVASKDMPESLLEAEQLLQQHGAIKDDIDRHQESYQQVMASGEKVISGQTDPEYQLLG
QRLGGLATGWGSLRRMWESRSHTLTQCLGFQEFQKDAKQAETILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLLSMKNNQNKVLSTIDSGNKLVAEGNLYSNKIKEKVQLIEDRHRKNS
KRAQEAGVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFMA
ELASHQGWLENIDAEGKQLMEEKPQYLALVSQRLEALHQLWNELQATTQETAQRLSAARS
SELRLQTHADLNKWIRAMEDQLRSDDLGRDLTSVNRMLAKLKRVEDQVNVRKEELRELFA
QMPSLEEEVEGEDLSIEKRFLDLLEPLGRRKKQLESSRAKLQLSRDLEDETLWVEERLPL
AQLADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQQLVEAAEIDCRDIEERLG
HLQGSWGTLQEAAAGRLQRLREASEAQQYYLDAEEAEAWISEQELYVISKETSEDEEGAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGRVDKQYAGLKDMAE
ERKRELENQYHLFQLRRETDDLEQWIAEKERVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAIIERLIDAGHAEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIEEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQMAYAGEKADTIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQERPRDVSSVELLKKYHQGIRAEIETRSKNFSACLELGESLQQRQHQASDEI
SEKLQQVVSRRKEMMEKWEARFEHLNMLLEVCQFSRDASAAEAWLIAHEPYLASQDFGHT
VDTVEKLIKKHEDFEKFTAASWEERFAALEKPTTLELKERQAPERPKKETTGPQEEESET
AGEGPRGPHRPATKTPSLGEEERPWPQDQQLPPLPGLHEEGQEEKSSADERPATEPLFKV
LDTPLSEGDEPTTLPAPRDHAHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSEL
TFYKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRRCCAA
Download sequence
Identical sequences XP_014408762.1.101512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]