SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014449958.1.47583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014449958.1.47583
Domain Number 1 Region: 26-201
Classification Level Classification E-value
Superfamily MIR domain 6.02e-62
Family MIR domain 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014449958.1.47583
Sequence length 218
Comment PREDICTED: stromal cell-derived factor 2 [Alligator mississippiensis]; AA=GCF_000281125.3; RF=representative genome; TAX=8496; STAX=8496; NAME=Alligator mississippiensis; AL=Scaffold; RT=Major
Sequence
MRLLLLAELALGLALGLGAAAAGGGSEPDAVTCGSVVKLLNVRHNVRLHSHDVRYGSGSG
QQSVTGVSAVDDSNSYWRIRGKTSTVCGRGTPVKCGQSIRLTHINTGRNLHSHHFTSPLS
GNQEVSAFGEDGEGDYLDDWTVVCSGPYWARDSEVRFKHSSTDVFLSVTGEQYGRPIHGQ
KEVHGMSYSNQNNYWKVMEGIFMKPSELLRMDPYHSEL
Download sequence
Identical sequences A0A151NCS7
XP_014449958.1.47583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]