SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014546282.1.23709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014546282.1.23709
Domain Number 1 Region: 333-519
Classification Level Classification E-value
Superfamily MIR domain 9.81e-51
Family MIR domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014546282.1.23709
Sequence length 765
Comment mannosyltransferase PMTI, partial [Metarhizium brunneum ARSEF 3297]; AA=GCF_000814965.1; RF=representative genome; TAX=1276141; STAX=500148; NAME=Metarhizium brunneum ARSEF 3297; strain=ARSEF 3297; AL=Scaffold; RT=Major
Sequence
MARSQTPQGSLRQRNVGSKKADSSTSAVDVELDKLAKASIKKNASNCERDHWAAFSLTTI
LAFVTRFWGISHPNEVVFDEVHFGKFASYYLERTYFFDVHPPFAKLLFAFMGWLVGYDGH
FHFENIGDSYIDNKVPYVAFRALPAILGALTVSVTYLIMWESGYSVPACLIAAGLVLFDN
AHIGQTRLILLDATLVLAMACSLLFYIKFYKLRHEPFSRKWWKWLILTGFALSCDMSTKY
VGTFAFVTIGAAVIIDLWDLLDIKRPGGAISLPQFGRHFAARAVGLIILPFLFYLFWFQV
HFAVLSRSGPGDDFMSPEFQETLSDNAMLANAVDIQYYDTITIKHKETKAFLHSHPHQYP
LRYDDGRVSSQGQQVTGYPHNDTNNYWQILPSSDDKQMGRKVKNNELIRLRHVGTDTVLL
SHDVASPYYPTNQEFTTVSQDDAYGSRVNDTLFEIRIENGKNGQEFKTIASYFKLIHFPS
KVAMWTHTKPLPEWGSHQQEINGNKQIAPSSNIWLVDNIASLAADDARREKPERKVKTLP
FLRKWFELQRAMFYHNSKLTSSHPYASHPYQWPFLLRGVSFWTQNDTRQQIYFLGNPIGW
WLASSLLAVYIGIVLADQISLRRGIDALDHRTRSRLYNSTGFFWVAWATHYFPFFVMGRQ
LFLHHYLPAHLASCLVAGALIEFVFSAEPVDETRGPRKSPKKHLTARERLAGQSMMGAWI
ACGVVLTIVIAGWWFFLPLTYGYPGLSVEQVVRRKWLGYDLHFAK
Download sequence
Identical sequences A0A0B4GH19
XP_014546282.1.23709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]