SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014556327.1.39273 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014556327.1.39273
Domain Number 1 Region: 57-317
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-84
Family Capz beta-1 subunit 0.0000000953
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014556327.1.39273
Sequence length 320
Comment hypothetical protein COCVIDRAFT_99963 [Bipolaris victoriae FI3]; AA=GCF_000527765.1; RF=representative genome; TAX=930091; STAX=40125; NAME=Bipolaris victoriae FI3; strain=FI3; AL=Scaffold; RT=Major
Sequence
MSYPGGDAHDSREQRPIQAAESPGLETYEGAGTRRQYSSNPPLTSPAFFLAKHRKMADPI
DSALDLLRRLDPKDVKRNVDHIIQLNPSLEEDLLESVDIPLTVKKCSKTKRDFLCCDYNR
DGDSWRSPWSNEFEPPIDEGVTPSDRVRKMEVKANEAFDVYRELYFEGGISSVYLWDMDD
GFAGCVLLKKSVSPTPKSSGSWDSIHVFDAQDRARTSHYKLTSTVILSLGTDSEALGGLD
LSGNMVRQVEADMAVEDDTSHVANIGKMVEDMELKMRNLLQEVYFGKAKDVVGDLRSLQS
LSQANKDRATQREMINSMGR
Download sequence
Identical sequences W7ELE2
jgi|Cocvi1|99963|e_gw1.45.301.1 XP_014556327.1.39273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]