SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014580864.1.58995 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014580864.1.58995
Domain Number 1 Region: 5-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.62e-81
Family Capz beta-1 subunit 0.0000000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014580864.1.58995
Sequence length 283
Comment WASH complex, F-actin capping protein, beta subunit, partial [Metarhizium majus ARSEF 297]; AA=GCF_000814945.1; RF=representative genome; TAX=1276143; STAX=1650735; NAME=Metarhizium majus ARSEF 297; strain=ARSEF 297; AL=Scaffold; RT=Major
Sequence
MAEIDPFDSALDLLRRLNPKHTASHLNAIISLAPDLAEDLLSSVDAPLMARRCKQSGREY
LLCDYNRDGDSYRSPWSNQFDPPLDEAGAGGVGADGNEGAGEGAIPSERVRKMEVKANDV
FDIYRDLYYEGGVSSVYLWNLDDGFAGVVLLKKSITPGRSTEGIWDSIHVFEAIERGRMT
HYKLTSTVILTLAAAGGSLGDMDLSGNMTRQVEQDMPVDGDDSHIVNVGRLVEDMELKMR
NLLQEVYFGKAKDVVGDLRSVGSLSDGARDREAQRELIGSMRR
Download sequence
Identical sequences A0A0B4HR10
XP_014580864.1.58995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]