SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014701085.1.49734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014701085.1.49734
Domain Number 1 Region: 465-720
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 164-403
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-49
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 3 Region: 768-1027
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 4 Region: 1-113
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-22
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 5 Region: 722-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1158-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000995
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1079-1119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000114
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1120-1156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 116-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000598
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1037-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000281
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014701085.1.49734
Sequence length 1446
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Equus asinus]; AA=GCF_001305755.1; RF=representative genome; TAX=9793; STAX=9793; NAME=Equus asinus; breed=Guanzhong donkey; AL=Scaffold; RT=Major
Sequence
MDGSSRFIIINTEIYWPNGLTLDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHP
FALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCG
IDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTP
DFTDIVLQLEDIRHAIAIDYDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDG
IAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGE
IPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVL
VEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRII
GSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISL
ETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYP
EGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEW
GGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREV
IADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ
AGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRM
VIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSV
PNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPE
KGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIE
SSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQ
LSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPP
TCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRC
NGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPA
PQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVP
HPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNP
PPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRM
TSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPS
PCTDSS
Download sequence
Identical sequences XP_014701085.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]