SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014736076.1.99236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014736076.1.99236
Domain Number 1 Region: 616-871
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 5-264
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 314-548
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 919-1178
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 873-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1309-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000956
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1231-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 571-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 1271-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 267-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000269
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1188-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000754
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014736076.1.99236
Sequence length 1596
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Sturnus vulgaris]; AA=GCF_001447265.1; RF=representative genome; TAX=9172; STAX=9172; NAME=Sturnus vulgaris; AL=Scaffold; RT=Major
Sequence
MRAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVFLKGLIYWSDVSEEAIK
RTEFNKSGSVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQE
LDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQKL
YWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGE
DLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKL
LENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYW
TDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTM
RKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLA
LDYAESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIE
RVHKCTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPI
GLELISDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRI
YWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDG
QHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGL
TIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIE
RANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGC
PAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLD
KQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATN
VINVTRLDGRAMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVL
FFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENW
LYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGCSH
ICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTEC
EDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRCASG
QCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQR
VLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSS
GPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYS
YRPYSYRHFAPPTTPCSTDVCDSDYGPSRRVPAAAAKGYTSDLNYDSEPVPPPPTPRSQY
LSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_014736076.1.99236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]