SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014737172.1.99236 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014737172.1.99236
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.05e-134
Family Capz beta-1 subunit 0.000000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014737172.1.99236
Sequence length 277
Comment PREDICTED: F-actin-capping protein subunit beta isoform X1 [Sturnus vulgaris]; AA=GCF_001447265.1; RF=representative genome; TAX=9172; STAX=9172; NAME=Sturnus vulgaris; AL=Scaffold; RT=Major
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN
Download sequence
Identical sequences A0A1V4KP60 P14315
ENSGALP00000006415 1izn_B 1izn_D 2kz7_B 3aaa_B 3aae_B 3aae_D 3aae_F 3aae_H 3aae_J 3lk3_B 3lk4_2 3lk4_5 3lk4_8 3lk4_B 3lk4_E 3lk4_H 3lk4_K 3lk4_N 3lk4_Q 3lk4_T 3lk4_W 3lk4_Z 1iznB NP_990768.1.86415 XP_005145483.1.78019 XP_005229684.1.75256 XP_005293025.1.60341 XP_005528314.1.90289 XP_006115115.1.96668 XP_009888271.1.48241 XP_010575563.1.12557 XP_011583439.1.59079 XP_014128779.1.73095 XP_014457461.1.47583 XP_014737172.1.99236 XP_015152321.1.86415 XP_015737800.1.68032 XP_015737801.1.68032 XP_017688887.1.3805 XP_017941794.1.51550 XP_019367456.1.87953 XP_019397041.1.79039 XP_021272945.1.32913 XP_021389454.1.53032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]