SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014755024.1.954 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_014755024.1.954
Domain Number - Region: 349-438
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0152
Family Myosin rod fragments 0.006
Further Details:      
 
Domain Number - Region: 231-338
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014755024.1.954
Sequence length 442
Comment PREDICTED: protein NETWORKED 4A-like [Brachypodium distachyon]; AA=GCF_000005505.2; RF=representative genome; TAX=15368; STAX=15368; NAME=Brachypodium distachyon; strain=Bd21; AL=Chromosome; RT=Major
Sequence
MKPPLERNPTKKRHSWWWDSHISPKNSKWLAENLEEMDKQVKEMVQLIEEDGDSFAKKAQ
MYYQRRPMLITHVENFYRMYRALAERYDNVTGELRKNIPSRLHSPGSLTGSECGSELQRS
PSPSPEPHKSWTREQSPRAAGFDFFLSNKSYDSPSSRKEPESASQSESDAKSEDCEDDGI
AYTLHQRVLELEDELNVANQKLRDANEKLEVFEEKSLRCHCDCKENGNGANYATKIEDIE
GELRSTRERLLSSQEEINNLQRSFGNLSEEHFGLMKQNKELGADIVNLKEEVVSARRRFD
DKLSESDAEISKYRQELAAASKRLLQEKSTNSAEVTKLQETIQGTRRKLEEVSEEKSLVE
DLVKELEEANAEAEKQRQELIHATEMLSEDKFRHEAEILTMQQSIEDLKPELESITKEKS
LLRSWFADLERVVERGRSVVQE
Download sequence
Identical sequences I1HCC7
EG:BRADI2G04170.1 EG:BRADI2G04170.2 XP_014755023.1.954 XP_014755024.1.954 15368.BRADI2G04170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]