SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014814735.1.91963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014814735.1.91963
Domain Number 1 Region: 619-874
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 8-267
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000156
Further Details:      
 
Domain Number 3 Region: 318-553
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-50
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 922-1181
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 5 Region: 876-924
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1234-1272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1312-1350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000283
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1274-1310
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 574-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000396
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 10 Region: 270-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000305
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1191-1244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_014814735.1.91963
Sequence length 1584
Comment PREDICTED: low-density lipoprotein receptor-related protein 6, partial [Calidris pugnax]; AA=GCF_001431845.1; RF=representative genome; TAX=198806; STAX=198806; NAME=Calidris pugnax; AL=Scaffold; RT=Major
Sequence
MALPEAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVKGLIYWSDVSEE
AIKRTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLF
WQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEE
QKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKY
SGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTG
VKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGY
IYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLN
GTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPN
GLALDYAENKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRR
SIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEENGGCSHLCLYRPQGPRCA
CPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTD
NRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSK
LDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRA
NGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRR
SIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFV
CGCPAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYD
PLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCE
ATNVINVTRLDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTER
EVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVF
ENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNIQEYRQHPCSQDNGG
CSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGF
TECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEKNCEVLCLTDQFRC
ASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFI
CQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMG
GSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHR
SYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVAAAAAKGYTSDLNYDSEPVPPPPTPR
SQYLSAEENYESCPPSPYTERSYS
Download sequence
Identical sequences XP_014814735.1.91963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]