SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014817903.1.91963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014817903.1.91963
Domain Number 1 Region: 24-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2180-2296
Classification Level Classification E-value
Superfamily PH domain-like 9.18e-38
Family Pleckstrin-homology domain (PH domain) 0.00000279
Further Details:      
 
Domain Number 3 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 590-729
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-32
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 5 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-29
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 6 Region: 1526-1680
Classification Level Classification E-value
Superfamily Spectrin repeat 3.08e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-28
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 8 Region: 1845-1999
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 9 Region: 799-938
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 11 Region: 1685-1790
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 13 Region: 733-833
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-20
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 14 Region: 1326-1437
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-18
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 15 Region: 1973-2065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000131
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_014817903.1.91963
Sequence length 2350
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X3 [Calidris pugnax]; AA=GCF_001431845.1; RF=representative genome; TAX=198806; STAX=198806; NAME=Calidris pugnax; AL=Scaffold; RT=Major
Sequence
MELQKSTGMPGPLSPGYAAQAPYNYNQLEGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVAKELETENY
HDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLS
QDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRV
AHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSV
VRLLSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIRERIKDIREQWANLEQLS
AIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEI
ASYRPTIDSLHEQAKALPQEHVGSPDVQGRLSGIEERYKEVAELTRLRKQALQDTLALYK
MFSEADACELWINEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIRE
KTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAI
LSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNT
LTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHRKNREAASELLMRLKD
NRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLEKI
EKEGMQLVAEKPETEAVVKEKLTGLHQMWEELESTTQTKAQRLFDANKAELFTQSCADLD
KWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQSQAKALSQEGKST
DEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEILWVGERMPIATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERRQNIITEGSPNAEAIQQRLADLQQLW
NLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKH
QILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYAGLKDLAEERRGKL
DERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQER
VDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDA
KEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAY
AGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQI
EAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQ
LTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEK
LIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRQPPTPEPSPKAAEDAD
SQQQRRDGTKGEQVSQNGLPSDQESPRVAETAEANEMVNGAAEQRTSSKESSPVPSPTAD
RKAKTAVQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHSKKASSRSWHNVYCVINNQE
MGFYKDSKAAASGIPYHNEIPVSLKEAVCEVAVDYKKKKHVFKLRLSDGNEYLFQAKDDE
EMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTITSESSPGKREKDKEKDKE
KRFSLFGKKK
Download sequence
Identical sequences XP_014817903.1.91963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]