SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014898827.1.100837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014898827.1.100837
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-56
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-53
Family YWTD domain 0.00000145
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-52
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 4 Region: 935-1191
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-43
Family YWTD domain 0.0000179
Further Details:      
 
Domain Number 5 Region: 1320-1357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1240-1281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000124
Family EGF-type module 0.007
Further Details:      
 
Domain Number 8 Region: 891-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 1282-1318
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1199-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000368
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014898827.1.100837
Sequence length 1608
Comment PREDICTED: low-density lipoprotein receptor-related protein 6-like isoform X2 [Poecilia latipinna]; AA=GCF_001443285.1; RF=representative genome; TAX=48699; STAX=48699; NAME=Poecilia latipinna; AL=Scaffold; RT=Major
Sequence
MGMCVRILLLLGSCWLVSGEPLLLYANRRDLRLVDAARDKANATVVVGGLEDAAAVDYVY
AQGLIYWSDVSEEAIKRTSFNRTGAGAPQTVVPGLVAPDGLACDWLGLKLYWTDSDTNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGDVPKIERAGMDGTNRSLLVDQ
DIHWPNGLTVDYGQQKLYWADAKHNFIHRCNLDGSSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGREQRVVHSHIFSPMDLHVFSPKRQPVSRSSPCSHGNAGCSHLCL
LSPTRPFYRCACPTGVQLLEDGQTCRDGATQMLLLARRTDLRQISLDTPDFTDVILQVGD
IRHAIAIDYDPVDGYIYWTDDDVKAIRRARLDGGDAQFVVTSQVSHPDGIAVDWIARNLY
WTDTGTDRIEVTRLDGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDG
LERLVMVNTSLGWPNGLALDYEQRQIYWGDAKTDKIEVMNMNGTGRRVLVEDKLPHIFGF
SLLGDFVYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATHLHRAAGTNPCADSNGG
CSHLCLHTPHGVRCGCPNGLELLGDLQSCIVPEAFLLFSRHTDIRRISLETNSNNVAIPL
TGVKEASALDFDITDNRIYWTDITLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAAM
DGTGRITLVSNVGRANGLTIDYAERRLYWADLDTTLIESSNMLGKEREVIADDLPHPFGL
TQYQDYIYWTDWSHRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQAGWNACASTNG
HCSHLCLAVPSGFVCGCPAHFSLNRDNKTCSAPTAFLLFSQKAAINRMVIDEQQSPDIVL
PIQNLKNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSVTVVSSSLLGPFDLSIDIFS
RFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLQDRSPKIER
AALDGTEREVLFFSNLGKPVALAVDNEAGKLFWVDSDLRRIESSDLSGANRIVIADSNIL
QPVGLTVFGNHLYWIDKQQQMIERIDKTTREGRTKVQARVAYLSDIHAVHEIDMHEYRNH
PCTRDNGGCSHICIVKGDGTTRCSCPVHLVLLSDELTCGEPPTCSPDQFACVSGEVDCIP
NTWRCDGFAECDDHSDEKECPVCSESEFQCDSRQCVGQSERCNGEVNCQDGSDENKCEVR
CPADQFSCANSQCIGIHKKCDHNTDCSDNSDEMDCFTDPPELPAPTNSTISSIVAVVMAL
FVVGAIYFVCQRVLCPHMKDDGETVANDFVVHGQPSVPLGYVPHPGSLSSSLPGMSRGKS
VIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYTLEFGY
SSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRPLKSAAKGYTSDLNYDSE
PFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_014898827.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]