SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_014968988.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_014968988.1.72884
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.15e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-51
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 783-1053
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-36
Family YWTD domain 0.000086
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-27
Family YWTD domain 0.0000814
Further Details:      
 
Domain Number 5 Region: 1184-1220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1146-1182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1106-1144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000172
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000115
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000596
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1063-1115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_014968988.1.72884
Sequence length 1464
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDI
QVLSQERQPFFHTRCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDNGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
ALHPVMGLMYWTDWGENPKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPHATRCGCPIGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVVEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHHTLDPSSRNCSPP
TTFLLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQAGAPLEGCGVLPKPFVLTSLSQGQNPDRQPHDLSIDIYSRTLFWTCEATNTINVH
RLSGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGL
IRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPLGLTVLGKHLYWID
RQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAK
GDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSD
EEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLI
KQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVV
CQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVP
LYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPY
IIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCP
PSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_014968988.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]