SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015007457.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015007457.1.72884
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000275
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015007457.1.72884
Sequence length 227
Comment PREDICTED: lysM and putative peptidoglycan-binding domain-containing protein 1 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MASPSRQPPPGGSGLLHGSRARSYGSLVQSACSPVRERRLEHHLEPGDTLAGLALKYGVT
MEQIKRANRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEEVRPSNDEVWPHS
TERKKQETGAGRANGEVFPTLGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGE
SGVPGEDAGLHLSSPRMQQRAVLGPVPLTRTSRTRTLRDQEDEIFKL
Download sequence
Identical sequences F7AZF7
ENSMMUP00000010369 ENSMMUP00000010369 XP_015007450.1.72884 XP_015007457.1.72884 9544.ENSMMUP00000010369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]