SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015076258.1.21931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015076258.1.21931
Domain Number 1 Region: 12-106
Classification Level Classification E-value
Superfamily Translation proteins 2.12e-35
Family Ribosomal protein L35ae 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015076258.1.21931
Sequence length 112
Comment PREDICTED: 60S ribosomal protein L35a-3 [Solanum pennellii]; AA=GCF_001406875.1; RF=representative genome; TAX=28526; STAX=28526; NAME=Solanum pennellii; AL=Chromosome; RT=Major
Sequence
MVKGRQGERVRLYTRGTVLGYKRSKSNQYPNTSLVQIEGVNTKEEVDWYLGKRMAYVYKA
KTKKNNSHYRCIWGKVCRPHGNSGVVRAKFKSNLPPKSMGAKVRVFMYPSNI
Download sequence
Identical sequences A0A0V0H0P0 M1CLD3
PGSC0003DMP400047245 NP_001307027.1.44838 XP_004239927.1.44838 XP_006355673.1.80749 XP_015076257.1.21931 XP_015076258.1.21931 XP_019069289.1.44838 XP_019069386.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]