SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015141566.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015141566.1.86415
Domain Number 1 Region: 95-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000186
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015141566.1.86415
Sequence length 356
Comment PREDICTED: vacuolar protein sorting-associated protein 37C isoform X1 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MDTLKDRTVEELQALQEDAAEIERLALESREVQELQLEREMALAANRSLAEQNLKFQVPL
ETGRSELSSKYEELQKLAEHCKEQKAKLEKFSASMHPQMLLDLLQVESQKIEEESEKMAE
KFLEGEVALETFLEQFSVMRKLSHLRRVRVEKLQEVLRKSRAPQEPVRDSQQQQQPPCVP
VDPPQPLPVPSGAPSLPLPYSPAPAMPLGPTAHGALPPAPFAGAPLATGNVAASQPGTQP
AFPYQPPPGATYPPLQAADSTPGYPKPPPGASSAPAYSWSPSRGPPRAPSFPSTPPPRPG
YPPYALPGAGRPQCPYPTQPPLPSFPLPPQPPYPPGPPYGYHPPPGNPPRPAWPGN
Download sequence
Identical sequences A0A1D5PEU0
XP_015141565.1.86415 XP_015141566.1.86415 ENSGALP00000008333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]