SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015179928.1.70865 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015179928.1.70865
Domain Number 1 Region: 1437-1630
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000471
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 2 Region: 1600-1794
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000536
Family Tropomyosin 0.0029
Further Details:      
 
Domain Number 3 Region: 388-612
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000291
Family Tropomyosin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015179928.1.70865
Sequence length 1929
Comment PREDICTED: rootletin isoform X2 [Polistes dominula]; AA=GCF_001465965.1; RF=representative genome; TAX=743375; STAX=743375; NAME=Polistes dominula; AL=Scaffold; RT=Major
Sequence
MDPTYSTVSCPEDDEETLSPEALVRQNYELRHRLEEEAACYKRRLDTYRQAQQHQAALVS
RLQAKVLQYKQRCSELENVMAETAAIDNSKLPIQPQSTSALDVAHQTLREMREEQIHDLD
TALNKLAEERKKCEKLLELNTSLKDQLEETSQTNEALTNDLQKLSNDWDVLREELTIKEE
EWKEEEQAFNDYYTSEHNRLLNLWRDVVSVKRLFADIKSSTDRDLSKLSNQITSTTNDIV
STCNNTSIFMKMQANLIQPSVAQQIHESQIVMEMKSEMGSLKQQYDVAQNEIRMKDDRIN
QLIREIHALEERCGEAEAQTNNITRMQEDIEVLQNALRDIAHTVIQDAETRDSENTQPPP
HVHLSPTGPIPQRSPRRGGRANTIPAFAESTISAVQAALHKYQLTIHDLQVKLQTHKEQL
SSFRKQSENAEENVRTLQVKVTELVEELDSTRSQCTQLVQEKEVLQKNLDTIKMEKNVLE
KNRMEINAMVETLNADYDKIQKANNKLQKMCDSLEDDKLYLQGELERLSKDAELRELSLR
SEENRCSKMREELLTLQEELNKTYLKKDMLEQQKLETDALISQIEKSKGDLELELEHLLL
EKSDLKEVLLKLESVCSNHEQDKQRLQEELKKTTEEKNKLANQCTDQQGDLGSLRKELLQ
AEQTRLDLESDKVTLNEKVKFLEIEKEKIEMELSQVTRERSDLSNQLSVLARKKETLNEE
LMRVRQRLEQANEMNSRINRSLEDLVKDNEEKQVLLETNEKELQRLQEQIASIRSEKETL
EGVLYDTQTNLESTHIKKSQLEKEQKELLIKQETLKGHIGRLSKDLENSQKQSQDIKQAL
AQQCCDQEANFQQALFNLKKQNEENVKKLNEEKEQLKVTLEKRLQQSLSQLGGEKNDEIN
QLQQRVQELQQHIENLCQQHEEVLLRAENDKQQALLIAHHDQQALMEKLENALRELEEEK
GNLERLKRDTTIRSEQDRNNLNQLRDNLNRFKTKLDETKLKGDEDKLKLELKIEELLKER
ESVQKESEELRVQLHMAEDKLDGLHNQLHETVRKLKDYENVNDTLRKELVDVRRQLTDST
FEKEKYNTSNKELREHIKRIEGEKREQGRALEETYQKIAALEDAKTGMETERSRLQAQFR
DMERDLIQVQQQLRLTQDELQKSTENNAQAQNNEKELQARLANETEERERLQLQLHQVKK
QVLDLDNSLEVTRQELGKLRSRSDEEDERWRSREQELLLRLEDSRCRERKLEDQKHNLEV
CLADASQQIQELKARLGGSEGRVRALDAQLSQLEVAKKEVEQKLSSIGLTLRRIAGIQMD
GSVNMPFKLMSPSRRWSPARGHEHGDSSKDIVIDVDPEAVRRGMRSLMQQVAQIERERDD
YKTELSSVKTQLTEYQENQNKVDERLNNLLSSIRTMQEEKNSLEARISQRETSHQSQMDI
LQQKTDECDQLREKVISLEMIVNSDTEEKNLYEEKLEKMKQTLNRMENERRNLQEELSKS
EARATKLELQRMSLDGDLQRLQMMLQEREANVQKLQDRCESQNRTTAGLEERCASLKSTI
EQLNLALEKSFNTESELKNEINLLQRNLMESTTCSQSNNEKLKQLQKQLSNTENERRVMA
ERLDSVQQSLSDLRHMNQNLQDQVARLQTELANNEVQRSGLEAQLRLTKWPQEGSADKDE
DLMRQLQIIQREKSEMRGKLDTLNDKVKLLETEKRSLETQVSTLKSVGTRSKSYERPEKA
HIELLGSSYSFDNLEQENRELRLKIRRLETQLAEKEAELIRTKSVYTHSHSALESSRDRT
GEIERLRAAQLQAEKLLEAREQSHRQQIIRLENQIQLLREQLNQEIKRRQLYVLRSSRAG
REMQQLRQALGDSLRTVAQDPSLDAVLLEHEARKLDNTLTSTTSLPPSLALAPSSAYDRS
STPSRLEKT
Download sequence
Identical sequences XP_015179928.1.70865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]