SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015208455.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015208455.1.81211
Domain Number 1 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 332-567
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-50
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 4 Region: 936-1195
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-42
Family YWTD domain 0.0000363
Further Details:      
 
Domain Number 5 Region: 1326-1364
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000156
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 1247-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 8 Region: 588-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000351
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1288-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 10 Region: 284-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000693
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1205-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000513
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015208455.1.81211
Sequence length 1612
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MGAVLRSLLLCSFCSVIRGAPLLLYANRRDLRLVDAARGQGNATVVVSGLEDAAAVDFVY
SKGLIYWSDVSEEAIKRIVFNQSGSVHSVVVSGLVSPDGLACDWLGSKLYWTDSETNRIE
VSNLDGSLRKVLFWQDLDQPRAITLDPARGYMYWTDWGEVPKIERAGMDGTNRSIIIDRN
IYWPNGLTLDYIEKKLYWADAKYNFIHRSNLDGTSREVVVEGSLPHPFALTLFEDTLYWT
DWNTHSIHSCNKTSGSNRREVHTNIFSPMDIHVFNQKRQPALANNPCGENNGGCSHLCLM
SPVKPFHQCACPTGVQLLGDGKTCKDGASELLLLARRTDLRRISLDTPDFTDIILNLDDI
RHAIAIDYDPVEGHIYWTDDEVHAIRRSYLDGTGSQFLVTSQVNHPDGIAVDWIARNLYW
TDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPMSGYMYWTDWGEIPKIERAALDGT
DRVVMVNTSLGWPNGLALDYAEKKIYWGDAKTDKIEVMSMDATGRRILVEDKLPHIFGFT
LLGDFIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCADENGGC
SHLCLYKPQGVQCACPIGLELISDMSTCIVPEAFLLFSRHTDIRRISLETNNNNVAIPLT
GVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNL
YWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMD
GTGRITLVPNVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQEREVIADDLPHPFGLT
QYQDYIYWTDWSQRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQGGWNACASTNGH
CSHLCLAVPVSSFVCGCPAHYSLNSDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDIIL
PIHSLRNVRAIDYDPLDKHLYWIDSKQNVIRRAQEDGNQSMTVVSSAVTSHGLGMQPHDL
SIDIYSRFIYWTNEITNVINVTRTDGRRVGVVLRGEQDRPRAIVVNPERGYMYFTNLQDR
SPRIERAALDGTEREVLFFTGLGKPVALAIDNELGKLFWVDSDLRRIESSDLSGADRIVI
EDSNILQPVGLTVFGNHLYWIDRQQQMIERIDKVTREGRTKIQARIASLSDIHAVSELDM
REYRKHPCTLENGGCSHICIVKGDGTTRCSCPVHLVLLPDELSCGEPPTCSPEQFSCSSG
DVDCIPQAWRCDGYPECDDGSDEEDCPVCSDTQFQCDSRQCVDIIMRCNGEINCQDKSDE
NKCEVLCPVDQFMCSNGQCIGKHKKCDHNTDCTDNSDELGCYPTEEPSPQPTNTIGSIIG
VILALFVVGAMYFVCQRVLCPHMKDDGETMTNDFVVHGASSVPLGYVPHPNSLSGSLPGM
SRGKSVMSSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYT
LEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPSRRIITAAKGYTSDLN
YDSEPFPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_015208455.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]