SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015217686.1.81211 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015217686.1.81211
Domain Number 1 Region: 131-254
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-38
Family FKBP immunophilin/proline isomerase 0.00034
Further Details:      
 
Domain Number 2 Region: 24-137
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-36
Family FKBP immunophilin/proline isomerase 0.00014
Further Details:      
 
Domain Number 3 Region: 256-358
Classification Level Classification E-value
Superfamily FKBP-like 9.62e-29
Family FKBP immunophilin/proline isomerase 0.00089
Further Details:      
 
Domain Number 4 Region: 362-439
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000761
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015217686.1.81211
Sequence length 453
Comment PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP10 isoform X2 [Lepisosteus oculatus]; AA=GCF_000242695.1; RF=representative genome; TAX=7918; STAX=7918; NAME=Lepisosteus oculatus; AL=Chromosome; RT=Major
Sequence
MESTLVLLFLSAVGAGVWGDPGPLEDVVIDRYFVPKVCPREVQTGDHVRYHYNGTFPDGK
KFDSSHDRGLPFSGLVGLGRLITGMDRGIQGMCITERRKITVPPHLAYGSLGAGNVIPPD
TTLVFDVLLLDIWNPDDKVQTRTLDKPQDCKRTVQKSDFIRYHYNGTLLDGTPFDSSYTR
NHTYNTYIGMGYVIAGMDKALQGVCIGERRRVTLPPHLAYGENGAGESIPASAVLVFDIH
VIDFHNPNDVVEIETTFRPPDCNLTSASNDLVYYHYNCSLLDGTFLFSSNDFDHPQEAFL
GANKVIDGLDAGMQGMCVGERRVVVVPPHLGHGEEGARGVPGSAVLRFELELLKLEKGVP
DGYLFVWLEEPPENLFEALDLDKDKEVPLEEFSTFIKTQEAEGKGRLKPGQDPDVVIQDM
FGNQDRNKDGKITAEELKLKVDEDAEKMRHEEL
Download sequence
Identical sequences XP_015217686.1.81211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]