SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015231566.1.42780 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015231566.1.42780
Domain Number 1 Region: 1490-1711
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000405
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 2 Region: 1672-1881
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000196
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number 3 Region: 1126-1349
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000245
Family Tropomyosin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015231566.1.42780
Sequence length 2005
Comment PREDICTED: rootletin isoform X1 [Cyprinodon variegatus]; AA=GCF_000732505.1; RF=representative genome; TAX=28743; STAX=28743; NAME=Cyprinodon variegatus; AL=Scaffold; RT=Major
Sequence
MSAEENSDPDSNKLESVIQRLGESVLSEEKRLTIRGPSPDAPPTCLPARVREIVTKNLND
TGAMSSVMSLQEENRVLQGELARLEDLLAHSRADRDELAIKYGAISERLEQALRFETGEG
DHDSPESRSLAQQNVDLRRRLDEEQAAYKRKLTAYQEGQQRQAQLVQKLQAKVLQYKKKC
GDLEQMLQEKSSELEKHSICGETSNGRHRDEASNNLEEALIRLEEEQQRSSSLAAVNAML
REQLEQAGLANEALSQDIRRLTVDWTKAREELEQKESDWRREEESFHSYFSSEHGRLLKL
WRQVVGFRRHFCEMKSATERDLTDMRSELTRISHSARVSCSGLSASVDSRVAGEKALRTE
LEQQLRNRVVEMMNLQSRADAERSELNLRLSDVVRECERLKGQILERDGEISVLTRRLQE
ESCSEDTDAQQVRAHSEMLLDTLRDIAQTVLSDGESSSEADQDSSAAPFLALIRDASPRL
SSSPSKLVASSQASSLSSLSDAAMSALRSAVTNKTLQLQDARGRLLSAQSSLQQLRKQLS
ECDSARRDMEQRNQVLQREKDAAQRERESAQKEKERLKQERDMLAREKVKLENSVQAAES
SSQIVQMEREKLQLAVLAAQREREHEREEKEIALQERDRAKAETLRIQKQWDHSESRASA
QRGELSVVKETHQQGEVERQLLEREKEQLSEALARAKSSITELSLQLSKLQSEDAALRDS
VVKMGSMNEVLAQDKVDLNNYILKLEEEKSLLLTQKREAEQEKLTIRDELVRLEQDRLEL
QSGRVSLQQALQDTEQSRAGMETELRSLRAERLKMQEKVAQLCAEVASLGSELSLAQGEG
QKNEVALEEAGRGQAELARDKAALVVQLTASERENTVLSEELAAFRSERESLETSLFEAQ
QQLAQVESRRDQLEAENQSLRVRCETAAAELKRARSDGDNALAQAEREKQILTQTLNAAQ
LEAQQALRKATSEHQEEVERLVSEKEVVRHSLQMEHEAALRRLRQEMEDQQHRAKRDKED
LQEELRTLQHDRDQSLLQAETEKQQALSLKEAEKAVLSDRVSSLQAELSTAALEAERMAR
EAAHHKEQEQIRVGALTSEILELRSQLDETTSAQQREVHSLQELCTDLRSRADVAYKELE
QCRASLSTAEESRDKVRKDLLEAECRLSQNQETAENYRREAIELRHSLSDVTKERDALSQ
SNTQLRGTLRSAETERISVKRQCEEKEQRLAVLEENLSSAQKEVMELRSCLREVERSRLE
ARRELQELRRQLKILDAEKEQKEREVVELQTRLALEEQRDEERGKEVFCLKQKLTEAETT
RDAIKKELSLTQRRLTESESGWRSCERELTAQLQEAHGCEKKLQDEAKNLSLRAQAAQDA
AAQSSLKLSEAQGRLAATEAELTRAEASRRDLEFRLSSLQSALTRTLGIGASRRGRSPGG
SSTSPGSMSRHHSISPLRSSLSPPKEFRGSTPDNTLGSGAVSPERGDTPLPQSELDPDSL
RSGLRDFLQELRDAQRERDDARCQLGVLQRELEELKEERGSAQTRLSHLQNALQDMQEVK
RGLEERLTTNQILLQQQEEAVRRGDRERRALSDRVKELERSLQASEMDKKHIQDQLNKQR
AAEMRLEAERKRLREALEAAEARATRVELGRRSLEGELQRLKLSLGDREAESQATLQRHD
ALIKQVADGEARVSQLQREVDRLSQAVLKAQEGESVLKEKATSLSQTLQEVTDSHSSTQS
RLLALQKTLSSAEQDKRLLQERLDEVRAALAEGKRNMAALTDSVQNLQSELSQSELRREE
LEVELSSSQEALRQRSASLVEAQRSAQLAQTERAVVEERLRALQRAVALLETEKKDAERQ
AVRLEKDKNALRNTLDKVERQKLMSEEGSMRLSAEKSRLDRSLNTAEQELQEAQQQILML
QTQLAEMEHSHSLCESLVQQRDEVQREAERMRSSLRDVERTLGTRERAHRHRVKGLEEQV
STLKEQLQQEIKRRQPSLPPSLLTN
Download sequence
Identical sequences XP_015231566.1.42780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]