SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015265006.1.55130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015265006.1.55130
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-56
Family YWTD domain 0.0000029
Further Details:      
 
Domain Number 2 Region: 180-415
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-52
Family YWTD domain 0.00000282
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-40
Family YWTD domain 0.0000361
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-28
Family YWTD domain 0.0000578
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000995
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000242
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000203
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000035
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015265006.1.55130
Sequence length 1461
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Gekko japonicus]; AA=GCF_001447785.1; RF=representative genome; TAX=146911; STAX=146911; NAME=Gekko japonicus; AL=Scaffold; RT=Major
Sequence
MYWTDWGEVPKIERAGMDGSTRSVIINTDIYWPNGLTLDYEERKLYWADAKLNFIHRSNL
DGTHRQAVVKGALPHPFALTLFGTTLYWTDWTTRSILACNKYTGENLREIHSNIFSPMDI
HVFSQQRQPNATNPCGTSNGGCSHLCLMSPLKPSYQCACPTGVKLLENGKTCKNGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAILRSFIDG
SSSQFVVQAQIAHPDGIAVDWIARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
ALDPMTGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYAENKIYWGDAKT
DKIEVMDTDGTNRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKRTAEREIIIDQ
LPDLMGLKATNVHQVIGTNPCAESNGGCSHLCLYRPQGLRCACPIGLELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSSLEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYVKRRLYWTDLD
TNLIESSNMLGLNRDVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTVIQN
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNHDNRTCSA
PTSFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPVDKQLYWIDSRQNIIRK
SQEDGGQSFTVVTSPVPNQNLDIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPIGVV
LRSDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFSSGLSKPVALAIDG
QLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENRLYWIDRHQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNMQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
MHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVVWRCDGFTECEDDSDEKNCPVCSEA
QFQCESGQCIDSSLQCNGEANCQDSSDEKSCEVLCLSDQFRCASGQCIGKNKKCDHNLDC
SDNSDEQGCYTTEEPAPQASNTIGSIIGVILTVFVVGAMYFVCQRVLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDYAPSRRAVTAVGKGYTSDLNYDSEPVPPPPTPRSQYLSAEETYESCPPSPY
TERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_015265006.1.55130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]