SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_015297655.1.63531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015297655.1.63531
Domain Number 1 Region: 32-257
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.34e-74
Family Eukaryotic type heme oxygenase 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_015297655.1.63531
Sequence length 316
Comment PREDICTED: heme oxygenase 2 isoform X1 [Macaca fascicularis]; AA=GCF_000364345.1; RF=representative genome; TAX=9541; STAX=9541; NAME=Macaca fascicularis; AL=Chromosome; RT=Major
Sequence
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAKKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAGEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGMALAAGLLAWYYM
Download sequence
Identical sequences A0A2K5HLX3 A0A2K5XHM8 A0A2K6B769 G7Q0E3 I0FKU7
ENSMMUP00000012959 NP_001252998.1.72884 XP_011715891.1.29376 XP_011715892.1.29376 XP_011715893.1.29376 XP_011715894.1.29376 XP_011715895.1.29376 XP_011715896.1.29376 XP_011715897.1.29376 XP_011816717.1.43180 XP_011816718.1.43180 XP_011816719.1.43180 XP_011816720.1.43180 XP_011816721.1.43180 XP_011816722.1.43180 XP_011833866.1.47321 XP_011833868.1.47321 XP_011833869.1.47321 XP_011833870.1.47321 XP_014980970.1.72884 XP_014980971.1.72884 XP_014980972.1.72884 XP_015297652.1.63531 XP_015297654.1.63531 XP_015297655.1.63531 XP_015297656.1.63531 XP_015297657.1.63531 ENSMMUP00000012959 9544.ENSMMUP00000012959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]