SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015358748.1.40921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015358748.1.40921
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-54
Family YWTD domain 0.00000608
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-50
Family YWTD domain 0.00000255
Further Details:      
 
Domain Number 3 Region: 782-1042
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-38
Family YWTD domain 0.0000811
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-28
Family YWTD domain 0.0000814
Further Details:      
 
Domain Number 5 Region: 1173-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000159
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 134-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000493
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1052-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000791
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015358748.1.40921
Sequence length 1453
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Marmota marmota marmota]; AA=GCF_001458135.1; RF=representative genome; TAX=9994; STAX=9993; NAME=Marmota marmota marmota; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDI
QVLSQERQPSFHTQCEEDNGGCSHLCLLSPREPFYACACPTGVQLQEDGRTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGHVYWTDDEVRAIRRAYLDG
SGAQTLVSTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGESPKIECAHLDGRERRVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTERRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVIGTNPCAEGNGGCSHLCFFTPRATKCGCPIGLELLSDMRTCIVPE
AFLVFTSRAAIHRISLETNNNDVAIPLAGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNGMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQDRVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPP
SAFLLFSQKCAISRMIPDDQRSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPFVLTSPGQSQNLSPDRQPHDLSIDIYSRMLFWTCEATNTINVHRLDGDAMGVVL
RGERDRPRAIAVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNT
LGRLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLAVLGRHLYWIDRQQQMIERVEK
TSGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPV
HLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDELGCPVCSAAQ
FPCARGQCVDLRLRCDGEADCQDRSDEAHCDAICLPNQFRCASGQCVLIKQQCDSFPDCM
DGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGASGPF
PHEYVSGTPHVPLNFIAPGGSQHGPFTGISCSKSMMSSVSLMGGRSGPPLYDRNHVTGAS
SSSSSSTKATLYPPILNPPPSPATDPSLCHLDVFYSSNIPATARPYRPYIIRGMAPPATP
CSTDVCDSDYSTSRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCH
LFPPPPSPCTDSS
Download sequence
Identical sequences XP_015358748.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]